General Information

    • DRAMP ID

    • DRAMP00095

    • Peptide Name

    • Mesentericin Y105 (MesY105; Bacteriocin)

    • Source

    • Leuconostoc mesenteroides (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • mesY

    • Sequence

    • KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Lactobacillus, Leuconostoc, Pediococcus, Listeria monocytogenes, Listeria innocua, Listeria ivanovii.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00095 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C169H246N52O50S2

    • Absent Amino Acids

    • DMPQ

    • Common Amino Acids

    • G

    • Mass

    • 3870.25

    • PI

    • 8.82

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +4

    • Boman Index

    • -38.88

    • Hydrophobicity

    • -0.411

    • Aliphatic Index

    • 47.57

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 14105

    • Absorbance 280nm

    • 391.81

    • Polar Residues

    • 20

DRAMP00095

DRAMP00095 chydropathy plot

Comments Information

    • Function

    • Has bacteriocin activity.

    • PTM

    • Probablely contains one disulfide bond 9-14.

Literature Information

  • ·Literature 1

    • Title

    • Characterization and purification of mesentericin Y105, an anti-Listeria bacteriocin from Leuconostoc mesenteroides.

    • Reference

    • J Gen Microbiol. 1992 Dec;138(12):2725-2731.

    • Author

    • H©chard Y, D©rijard B, Letellier F, Cenatiempo Y.
  • ·Literature 2

    • Title

    • Mesentericin Y105 gene clusters in Leuconostoc mesenteroides Y105.

    • Reference

    • Microbiology. 1995 Jul;141 (Pt 7):1637-1645.

    • Author

    • Fremaux C, H©chard Y, Cenatiempo Y.