• DRAMP ID

    • DRAMP00095
    • Peptide Name

    • Mesentericin Y105 (MesY105; Bacteriocin)
    • Source

    • Leuconostoc mesenteroides (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • mesY
    • Sequence

    • KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW
    • Sequence Length

    • 37
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Antimicrobial
    • Target Organism

      • Lactobacillus, Leuconostoc, Pediococcus, Listeria monocytogenes, Listeria innocua, Listeria ivanovii.
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Formula

    • C169H246N52O50S2
    • Absent Amino Acids

    • DMPQ
    • Common Amino Acids

    • G
    • Mass

    • 4512.57
    • PI

    • 8.77
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 11
    • Boman Index

    • -38.88
    • Hydrophobicity

    • -41.08
    • Aliphatic Index

    • 47.57
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 14105
    • Absorbance 280nm

    • 391.81
    • Polar Residues

    • 20

DRAMP00095

DRAMP00095 chydropathy plot
    • Function

    • Has bacteriocin activity.
    • PTM

    • Probablely contains one disulfide bond 9-14.
  • Literature 1
    • Reference

    • J Gen Microbiol. 1992 Dec;138(12):2725-2731.
    • Author

    • H©chard Y, D©rijard B, Letellier F, Cenatiempo Y.
    • Title

    • Characterization and purification of mesentericin Y105, an anti-Listeria bacteriocin from Leuconostoc mesenteroides.
  • Literature 2
    • Reference

    • Microbiology. 1995 Jul;141 (Pt 7):1637-1645.
    • Author

    • Fremaux C, H©chard Y, Cenatiempo Y.
    • Title

    • Mesentericin Y105 gene clusters in Leuconostoc mesenteroides Y105.