• DRAMP ID

    • DRAMP00096
    • Peptide Name

    • Pediocin PA-1 (Pediocin ACH; Bacteriocin)
    • Source

    • Pediococcus acidilactici PAC-1.0 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • pedA
    • Sequence

    • KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC
    • Sequence Length

    • 44
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Listeria monocytogenes ATCC 19115-
        L. seeligeri ATCC 35967-
        Pediococcus pentosaceus JCM2026-
        P. pentosaceus JCM5890-
        Pediococcus acidilactici IAM1233-
        Lactobacillus plantarum JCM1149-
        Lactobacillus sakei IAM1900-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00096 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00096.
    • Formula

    • C196H297N61O60S5
    • Absent Amino Acids

    • EFLPR
    • Common Amino Acids

    • G
    • Mass

    • 4628.19
    • PI

    • 8.85
    • Basic Residues

    • 7
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +6
    • Boman Index

    • -49.55
    • Hydrophobicity

    • -0.493
    • Aliphatic Index

    • 40
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 14230
    • Absorbance 280nm

    • 330.93
    • Polar Residues

    • 24

DRAMP00096

DRAMP00096 chydropathy plot
    • Function

    • Has bacteriocin activity.
    • PTM

    • Probablely contains one disulfide bond 9-14.
  • ·Literature 1
    • Title

    • Cloning, expression, and nucleotide sequence of genes involved in production of pediocin PA-1, and bacteriocin from Pediococcus acidilactici PAC1.0.
    • Reference

    • Appl Environ Microbiol. 1992 Aug;58(8):2360-2367.
    • Author

    • Marugg JD, Gonzalez CF, Kunka BS, Ledeboer AM, Pucci MJ, Toonen MY, Walker SA, Zoetmulder LC, Vandenbergh PA.
  • ·Literature 2
    • Title

    • Purification and primary structure of pediocin PA-1 produced by Pediococcus acidilactici PAC-1.0.
    • Reference

    • Arch Biochem Biophys. 1992 May 15;295(1):5-12.
    • Author

    • Henderson JT, Chopko AL, van Wassenaar PD.