General Information

    • DRAMP ID

    • DRAMP00096

    • Peptide Name

    • Pediocin PA-1 (Pediocin ACH; Bacteriocin)

    • Source

    • Pediococcus acidilactici PAC-1.0 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • pedA

    • Sequence

    • KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Listeria monocytogenes ATCC 19115, L. seeligeri ATCC 35967, Pediococcus pentosaceus JCM2026, P. pentosaceus JCM5890, Pediococcus acidilactici IAM1233, Lactobacillus plantarum JCM1149, Lactobacillus sakei IAM1900.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00096 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C196H297N61O60S5

    • Absent Amino Acids

    • EFLPR

    • Common Amino Acids

    • G

    • Mass

    • 4628.19

    • PI

    • 8.85

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -49.55

    • Hydrophobicity

    • -0.493

    • Aliphatic Index

    • 40

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 14230

    • Absorbance 280nm

    • 330.93

    • Polar Residues

    • 24

DRAMP00096

DRAMP00096 chydropathy plot

Comments Information

    • Function

    • Has bacteriocin activity.

    • PTM

    • Probablely contains one disulfide bond 9-14.

Literature Information

  • ·Literature 1

    • Title

    • Cloning, expression, and nucleotide sequence of genes involved in production of pediocin PA-1, and bacteriocin from Pediococcus acidilactici PAC1.0.

    • Reference

    • Appl Environ Microbiol. 1992 Aug;58(8):2360-2367.

    • Author

    • Marugg JD, Gonzalez CF, Kunka BS, Ledeboer AM, Pucci MJ, Toonen MY, Walker SA, Zoetmulder LC, Vandenbergh PA.
  • ·Literature 2

    • Title

    • Purification and primary structure of pediocin PA-1 produced by Pediococcus acidilactici PAC-1.0.

    • Reference

    • Arch Biochem Biophys. 1992 May 15;295(1):5-12.

    • Author

    • Henderson JT, Chopko AL, van Wassenaar PD.