• DRAMP ID

    • DRAMP00096
    • Peptide Name

    • Pediocin PA-1 (Pediocin ACH; Bacteriocin)
    • Source

    • Pediococcus acidilactici PAC-1.0 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • pedA
    • Sequence

    • KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC
    • Sequence Length

    • 44
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Anti-Gram+, Antimicrobial
    • Target Organism

      • Gram-positive bacteria: Listeria monocytogenes ATCC 19115, L. seeligeri ATCC 35967, Pediococcus pentosaceus JCM2026, P. pentosaceus JCM5890, Pediococcus acidilactici IAM1233, Lactobacillus plantarum JCM1149, Lactobacillus sakei IAM1900.
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

    • Binding Target

    • N/A
    • Linear/Cyclic/Branched

    • N-terminal modification

    • C-terminal modification

    • Other modifications

    • Stereochemistry

    • Structure

    • Bridge
    • Structure Description

    • N/A
    • Formula

    • C196H297N61O60S5
    • Absent Amino Acids

    • EFLPR
    • Common Amino Acids

    • G
    • Mass

    • 5395.39
    • PI

    • 8.67
    • Basic Residues

    • 7
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 10
    • Boman Index

    • -49.55
    • Hydrophobicity

    • -49.32
    • Aliphatic Index

    • 40
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 14230
    • Absorbance 280nm

    • 330.93
    • Polar Residues

    • 24

DRAMP00096

DRAMP00096 chydropathy plot
    • Function

    • Has bacteriocin activity.
    • PTM

    • Probablely contains one disulfide bond 9-14.
  • Literature 1
    • Reference

    • Appl Environ Microbiol. 1992 Aug;58(8):2360-2367.
    • Author

    • Marugg JD, Gonzalez CF, Kunka BS, Ledeboer AM, Pucci MJ, Toonen MY, Walker SA, Zoetmulder LC, Vandenbergh PA.
    • Title

    • Cloning, expression, and nucleotide sequence of genes involved in production of pediocin PA-1, and bacteriocin from Pediococcus acidilactici PAC1.0.
  • Literature 2
    • Reference

    • Arch Biochem Biophys. 1992 May 15;295(1):5-12.
    • Author

    • Henderson JT, Chopko AL, van Wassenaar PD.
    • Title

    • Purification and primary structure of pediocin PA-1 produced by Pediococcus acidilactici PAC-1.0.