General Information

    • DRAMP ID

    • DRAMP00097

    • Peptide Name

    • Lactococcin MMFII (Pediocin-like peptide; Bacteriocin)

    • Source

    • Lactococcus lactis subsp. lactis (Streptococcus lactis) (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILW

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Lactococcus cremoris, Listeria ivanovii.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00097 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00097.

Physicochemical Information

    • Formula

    • C183H280N48O58S2

    • Absent Amino Acids

    • FMQR

    • Common Amino Acids

    • KS

    • Mass

    • 4144.64

    • PI

    • 6.43

    • Basic Residues

    • 5

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +1

    • Boman Index

    • -55.78

    • Hydrophobicity

    • -0.535

    • Aliphatic Index

    • 68.38

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14105

    • Absorbance 280nm

    • 391.81

    • Polar Residues

    • 17

DRAMP00097

DRAMP00097 chydropathy plot

Comments Information

    • Function

    • Bacteriocin active against Listeria monocytogenes and Lactococcus cremoris.

Literature Information

  • ·Literature 1

    • Title

    • Lactococcin MMFII, a novel class IIa bacteriocin produced by Lactococcus lactis MMFII, isolated from a Tunisian dairy product.

    • Reference

    • FEMS Microbiol Lett. 2001 Nov 27;205(1):49-55.

    • Author

    • Ferchichi M, Fr¨re J, Mabrouk K, Manai M.
  • ·Literature 2

    • Title

    • Chemical synthesis, molecular modeling, and antimicrobial activity of a novel bacteriocin, MMFII.

    • Reference

    • Biochem Biophys Res Commun. 2001 Nov 23;289(1):13-18.

    • Author

    • Ferchichi M, Fathallah M, Mansuelle P, Rochat H, Sabatier JM, Manai M, Mabrouk K.