General Information

    • DRAMP ID

    • DRAMP00100

    • Peptide Name

    • Sakacin G (SakG; Pediocin-like peptide; Bacteriocin)

    • Source

    • Lactobacillus sakei 2512 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • skgA2

    • Sequence

    • KYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGHGVC

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Streptococcus caprinus, S. macedonicus, Listeria innocua, L. sakei, L. ivanovii subsp. ivanovii and Listeria monocytogenes, Lactococcus lactis subsp. Lactis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00100 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C162H234N52O50S4

    • Absent Amino Acids

    • DEFIMPR

    • Common Amino Acids

    • G

    • Mass

    • 3838.2

    • PI

    • 7.9

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +4

    • Boman Index

    • -29.32

    • Hydrophobicity

    • -0.297

    • Aliphatic Index

    • 47.3

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 14230

    • Absorbance 280nm

    • 395.28

    • Polar Residues

    • 23

DRAMP00100

DRAMP00100 chydropathy plot

Comments Information

    • MOA

    • The mode of activity against Listeria innocua 2030C and L. ivanovii subsp. ivanovii ATCC 19119 was bactericidal, resulting in cell lysis and enzyme- and DNA-leakage.

Literature Information

  • ·Literature 1

    • Title

    • Sakacin G, a new type of antilisterial bacteriocin.

    • Reference

    • Appl Environ Microbiol 2002; 68: 6416-6420.

    • Author

    • Simon L, Fremaux C, Cenatiempo Y, Berjeaud JM.
  • ·Literature 2

    • Title

    • Characterization of a bacteriocin produced by Lactobacillus sakeii R1333 isolated from smoked salmon.

    • Reference

    • Anaerobe. 2011 Feb;17(1):23-31.

    • Author

    • Todorov SD, Rachman C, Fourrier A, Dicks LM, van Reenen CA, Pr©vost H, Dousset X.