• DRAMP ID

    • DRAMP00100
    • Peptide Name

    • Sakacin G (SakG; Pediocin-like peptide; Bacteriocin)
    • Source

    • Lactobacillus sakei 2512 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • skgA2
    • Sequence

    • KYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGHGVC
    • Sequence Length

    • 37
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknown
    • Biological Activity

    • Antibacterial, Antilisterial
    • Target Organism

      • Gram-positive bacteria: Streptococcus caprinus, S. macedonicus, Listeria innocua, L. sakei, L. ivanovii subsp. ivanovii and Listeria monocytogenes, Lactococcus lactis subsp. Lactis.
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Formula

    • C162H234N52O50S4
    • Absent Amino Acids

    • DEFIMPR
    • Common Amino Acids

    • G
    • Mass

    • 4480.53
    • PI

    • 7.96
    • Basic Residues

    • 4
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 9
    • Boman Index

    • -29.32
    • Hydrophobicity

    • -29.73
    • Aliphatic Index

    • 47.3
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 14230
    • Absorbance 280nm

    • 395.28
    • Polar Residues

    • 23

DRAMP00100

DRAMP00100 chydropathy plot
    • MOA

    • The mode of activity against Listeria innocua 2030C and L. ivanovii subsp. ivanovii ATCC 19119 was bactericidal, resulting in cell lysis and enzyme- and DNA-leakage.
  • Literature 1
    • Reference

    • Appl Environ Microbiol 2002; 68: 6416-6420.
    • Author

    • Simon L, Fremaux C, Cenatiempo Y, Berjeaud JM.
    • Title

    • Sakacin G, a new type of antilisterial bacteriocin.
  • Literature 2
    • Reference

    • Anaerobe. 2011 Feb;17(1):23-31.
    • Author

    • Todorov SD, Rachman C, Fourrier A, Dicks LM, van Reenen CA, PrĀ©vost H, Dousset X.
    • Title

    • Characterization of a bacteriocin produced by Lactobacillus sakeii R1333 isolated from smoked salmon.