• DRAMP ID

    • DRAMP00105
    • Peptide Name

    • Enterocin X alpha (Two-peptide bacteriocin)
    • Source

    • Enterococcus faecium KU-B5 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • enxA
    • Sequence

    • SNDSLWYGVGQFMGKQANCITNHPVKHMIIPGYCLSKILG
    • Sequence Length

    • 40
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknow
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-positive bacteria: Enterococcus faecalis JCM 5803 (MIC=50.8 nM), Enterococcus faecalis OU510 (MIC=102 nM), Enterococcus faecium TUA 1344L (MIC=50.8 nM), Enterococcus hirae ATCC 10541 (MIC=50.8 nM), Lactobacillus plantarum ATCC 14917 (MIC=102 nM), Lactobacillus sakeii ssp.sakei JCM 1157 (MIC=50.8 nM), Lactococcus lactis ssp.cremoris ATCC 19257 (MIC=813 nM), Listeria innocua ATCC 33090 (MIC=25.4 nM).
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00105 helical wheel diagram
    • Formula

    • C198H307N53O54S4
    • Absent Amino Acids

    • ER
    • Common Amino Acids

    • G
    • Mass

    • 5118.02
    • PI

    • 8.77
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 12
    • Boman Index

    • -17.14
    • Hydrophobicity

    • 0.75
    • Aliphatic Index

    • 85.25
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8605
    • Absorbance 280nm

    • 220.64
    • Polar Residues

    • 16

Amino Acid Distribution

DRAMP00105 chydropathy plot
    • EntXalpha and EntXbeta encode a double-glycine-type prepeptide with an 18-residue leader sequence, representing the typical structure of class II bacteriocin prepeptides. When combined, Xalpha and Xbeta display variably enhanced or reduced antibacterial activity toward a panel of indicators compared to each peptide individually.

  • Literature 1
    • Reference

    • Appl Environ Microbiol. 2010 Jul;76(13):4542-4545.
    • Author

    • Hu CB, Malaphan W, Zendo T, Nakayama J, Sonomoto K.
    • Title

    • Enterocin X, a novel two-peptide bacteriocin from Enterococcus faecium KU-B5, has an antibacterial spectrum entirely different from those of its component peptides.