• DRAMP ID

    • DRAMP00107
    • Peptide Name

    • Bacteriocin L-1077
    • Source

    • Lactobacillus salivarius L-1077 (NRRL B-50053) (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Unknow
    • Sequence

    • TNYGNGVGVPDAIMAGIIKLIFIFNIRQGYNFGKKAT
    • Sequence Length

    • 37
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknow
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-negative bacteria: Salmonella Enteritidis 1 (MIC=0.19 ug/ml), S. Enteritidis 4 (MIC=0.38 ug/ml), S. Enteritidis 204 (MIC=0.38 ug/ml), S. Enteritidis 237 (MIC=0.19 ug/ml), Salmonella Choleraesuis 434/4 (MIC=0.38 ug/ml), S. Choleraesuis 370 (MIC=0.19 ug/ml), Salmonella Typhimurium 483/6 (MIC=0.19 ug/ml), S. Typhimurium 44/8 (MIC=0.19 ug/ml), Salmonella Gallinarum-Pullorum (MIC=0.19 ug/ml), Escherichia coli HB 101 (MIC=0.19 ug/ml), E. coli-600 (MIC=0.19 ug/ml), E. coli O157:H7 Y-63 (MIC=0.19 ug/ml), E. coli O157:H7 G-35 (MIC=0.19 ug/ml), E. coli O157:H7 OD 30 (MIC=0.19 ug/ml), E. coli O157:H7 T lab 39 (MIC=0.19 ug/ml), Yersinia enterocolitica 03 (MIC=0.76 ug/ml), Y. enterocolitica 09 (MIC=0.76 ug/ml), Y. enterocolitica 11 (MIC=0.76 ug/ml), Citrobacter freundii (MIC=0.76 ug/ml), Klebsiella pneumoniae (MIC=0.76 ug/ml), Shigella dysenteriae (MIC=0.76 ug/ml), Yersinia pseudotuberculosis 4 (MIC=0.76 ug/ml), Y. pseudotuberculosis 99/14 (MIC=0.76 µg/ml), Pseudomonas aeruginosa 508 (MIC=0.38 ug/ml), Proteus mirabilis (MIC=0.38 ug/ml), Morganella morganii (MIC=0.38 µg/ml), Proteus vulgaris 7A (MIC=1.5 ug/ml),Campylobacter jejuni L-4 (MIC=0.09 ug/ml);
      • Gram-positive bacteria: Clostridium perfringens 13124 (MIC=0.7 ug/ml), Listeria monocytogenes A 9-72 (MIC=0.19 ug/ml), Staphylococcus aureus (MIC=0.76 ug/ml), Staphylococcus epidermidis (MIC=0.76 ug/ml).
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00107 helical wheel diagram
    • Formula

    • C185H290N48O49S
    • Absent Amino Acids

    • CEHSW
    • Common Amino Acids

    • GI
    • Mass

    • 4645.02
    • PI

    • 10.33
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 15
    • Boman Index

    • -12.93
    • Hydrophobicity

    • 26.22
    • Aliphatic Index

    • 97.57
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 82.78
    • Polar Residues

    • 14

DRAMP00107

DRAMP00107 chydropathy plot
    • No comments found on DRAMP database

  • Literature 1
    • Reference

    • Appl Environ Microbiol. 2011 Apr;77(8):2749-2754.
    • Author

    • Svetoch EA, Eruslanov BV, Levchuk VP, Perelygin VV, Mitsevich EV, Mitsevich IP, Stepanshin J, Dyatlov I, Seal BS, Stern NJ.
    • Title

    • Isolation of Lactobacillus salivarius 1077 (NRRL B-50053) and characterization of its bacteriocin, including the antimicrobial activity spectrum.