General Information

    • DRAMP ID

    • DRAMP00109

    • Peptide Name

    • Plantaricin C19 (Pediocin-like peptide; Bacteriocin)

    • Source

    • Lactobacillus plantarum C19 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • KYYGNGLSCSKKGCTVNWGQAFSCGVNRVATAGHGK

    • Sequence Length

    • 36

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Listeria grayi.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00109 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00109.

Physicochemical Information

    • Formula

    • C161H250N50O48S3

    • Absent Amino Acids

    • DEIMP

    • Common Amino Acids

    • G

    • Mass

    • 3750.24

    • PI

    • 9.57

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -44.66

    • Hydrophobicity

    • -0.425

    • Aliphatic Index

    • 43.33

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8605

    • Absorbance 280nm

    • 245.86

    • Polar Residues

    • 20

DRAMP00109

DRAMP00109 chydropathy plot

Comments Information

    • MOA

    • Plantaricin C19 exerts a bacteriostatic action on sensitive cells of Listeria grayi IP 6818 in BHI broth.

Literature Information

  • ·Literature 1

    • Title

    • Mode of action, purification and amino acid sequence of plantaricin C19, an anti-Listeria bacteriocin produced by Lactobacillus plantarum C19.

    • Reference

    • Int J Food Microbiol. 2001 Aug 15;68(1-2):93-104.

    • Author

    • Atrih A, Rekhif N, Moir AJ, Lebrihi A, Lefebvre G.