General Information

    • DRAMP ID

    • DRAMP00110

    • Peptide Name

    • Plantaricin 423 (Pediocin-like peptide; Bacteriocin)

    • Source

    • Lactobacillus plantarum 423 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • plaA

    • Sequence

    • KYYGNGVTCGKHSCSVNWGQAFSCSVSHLANFGHGKC

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Listeria spp., Staphylococcus spp., Pediococcus spp., Lactobacillus spp.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00110 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C170H249N51O50S4

    • Absent Amino Acids

    • DEIMPR

    • Common Amino Acids

    • G

    • Mass

    • 3935.4

    • PI

    • 8.87

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -36.23

    • Hydrophobicity

    • -0.278

    • Aliphatic Index

    • 39.46

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8730

    • Absorbance 280nm

    • 242.5

    • Polar Residues

    • 21

DRAMP00110

DRAMP00110 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterization and heterologous expression of a class IIa bacteriocin, plantaricin 423 from Lactobacillus plantarum 423, in Saccharomyces cerevisiae.

    • Reference

    • Int J Food Microbiol. 2003 Feb 25;81(1):29-40.

    • Author

    • Van Reenen CA, Chikindas ML, Van Zyl WH, Dicks LM.
  • ·Literature 2

    • Title

    • Expression of the immunity protein of plantaricin 423, produced by Lactobacillus plantarum 423, and analysis of the plasmid encoding the bacteriocin.isiae.

    • Reference

    • Appl Environ Microbiol. 2006 Dec;72(12):7644-7651.

    • Author

    • Van Reenen CA, Van Zyl WH, Dicks LM.