• DRAMP ID

    • DRAMP00111
    • Peptide Name

    • Penocin A (PenA; Bacteriocin)
    • Source

    • Pediococcus pentosaceus (strain ATCC 25745/183-1w) (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Not found
    • Sequence

    • KYYGNGVHCGKKTCYVDWGQATASIGKIIVNGWTQHGPWAHR
    • Sequence Length

    • 42
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Piscicola-
        Clostridia butyricum-
        Enterococcus faecium-
        Enterococcus faecalis-
        Lactobacillus curvatus-
        Lactobacillus casei-
        Lactobacillus sakeii-
        L. raffinolactis-
        Leuconostoc mesenteroides-
        Listeria innocua-
        Listeria monocytogenes-
        Pediococcus acidilactici-
        P. pentosaceus-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00111 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00111.
    • Formula

    • C212H312N62O56S2
    • Absent Amino Acids

    • EFLM
    • Common Amino Acids

    • G
    • Mass

    • 4689.31
    • PI

    • 9.45
    • Basic Residues

    • 8
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +7
    • Boman Index

    • -47.27
    • Hydrophobicity

    • -0.586
    • Aliphatic Index

    • 55.71
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 21095
    • Absorbance 280nm

    • 514.51
    • Polar Residues

    • 18

DRAMP00111

DRAMP00111 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Comparative genomics of the lactic acid bacteria.
    • Reference

    • Proc Natl Acad Sci U S A. 2006 Oct 17;103(42):15611-15616.
    • Author

    • Makarova K. et al Mills D.
  • ·Literature 2
    • Title

    • Data mining and characterization of a novel pediocin-like bacteriocin system from the genome of Pediococcus pentosaceus ATCC 25745.
    • Reference

    • Microbiology. 2006 Jun;152(Pt 6):1649-1659.
    • Author

    • Diep DB, Godager L, Brede D, Nes IF.