General Information

    • DRAMP ID

    • DRAMP00111

    • Peptide Name

    • Penocin A (PenA; Bacteriocin)

    • Source

    • Pediococcus pentosaceus (strain ATCC 25745/183-1w) (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • KYYGNGVHCGKKTCYVDWGQATASIGKIIVNGWTQHGPWAHR

    • Sequence Length

    • 42

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Piscicola, Clostridia butyricum, Enterococcus faecium, Enterococcus faecalis, Lactobacillus curvatus, Lactobacillus casei, Lactobacillus sakeii, L. raffinolactis, Leuconostoc mesenteroides, Listeria innocua, Listeria monocytogenes, Pediococcus acidilactici, P. pentosaceus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00111 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00111.

Physicochemical Information

    • Formula

    • C212H312N62O56S2

    • Absent Amino Acids

    • EFLM

    • Common Amino Acids

    • G

    • Mass

    • 4689.31

    • PI

    • 9.45

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +7

    • Boman Index

    • -47.27

    • Hydrophobicity

    • -0.586

    • Aliphatic Index

    • 55.71

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 21095

    • Absorbance 280nm

    • 514.51

    • Polar Residues

    • 18

DRAMP00111

DRAMP00111 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Comparative genomics of the lactic acid bacteria.

    • Reference

    • Proc Natl Acad Sci U S A. 2006 Oct 17;103(42):15611-15616.

    • Author

    • Makarova K. et al Mills D.
  • ·Literature 2

    • Title

    • Data mining and characterization of a novel pediocin-like bacteriocin system from the genome of Pediococcus pentosaceus ATCC 25745.

    • Reference

    • Microbiology. 2006 Jun;152(Pt 6):1649-1659.

    • Author

    • Diep DB, Godager L, Brede D, Nes IF.