General Information

    • DRAMP ID

    • DRAMP00113

    • Peptide Name

    • Enterocin A (EntA; Pediocin-like peptide; Bacteriocin)

    • Source

    • Enterococcus faecium (Streptococcus faecium) (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • TTHSGKYYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGGAIPGKC

    • Sequence Length

    • 47

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00113 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00113.

Physicochemical Information

    • Formula

    • C211H329N57O63S5

    • Absent Amino Acids

    • EQR

    • Common Amino Acids

    • G

    • Mass

    • 4832.58

    • PI

    • 9.07

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +5

    • Boman Index

    • -20.81

    • Hydrophobicity

    • -0.03

    • Aliphatic Index

    • 54.04

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10220

    • Absorbance 280nm

    • 222.17

    • Polar Residues

    • 26

DRAMP00113

DRAMP00113 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Biochemical and genetic characterization of enterocin A from Enterococcus faecium, a new antilisterial bacteriocin in the pediocin family of bacteriocins.

    • Reference

    • Appl Environ Microbiol 1996; 62: 1676-1682.

    • Author

    • erich T et al Nes IF.