General Information

    • DRAMP ID

    • DRAMP00116

    • Peptide Name

    • Bacteriocin 32 (Bac 32; Bacteriocin)

    • Source

    • Enterococcus faecium (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • FTPSVSFSQNGGVVEAAAQRGYIYKKYPKGAKVPNKVKMLVNIRGKQTMRTCYLMSWTASSRTAKYYYYI

    • Sequence Length

    • 70

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Enterococcus faecium, E. hirae, E. durans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00116 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00116.

Physicochemical Information

    • Formula

    • C364H567N97O98S4

    • Absent Amino Acids

    • DH

    • Common Amino Acids

    • KY

    • Mass

    • 7998.34

    • PI

    • 10.11

    • Basic Residues

    • 12

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 20

    • Net Charge

    • +11

    • Boman Index

    • -100.78

    • Hydrophobicity

    • -0.417

    • Aliphatic Index

    • 61.29

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 17420

    • Absorbance 280nm

    • 252.46

    • Polar Residues

    • 28

DRAMP00116

DRAMP00116 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Bac 32, a novel bacteriocin widely disseminated among clinical isolates of Enterococcus faecium.

    • Reference

    • Antimicrob Agents Chemother. 2006 Apr;50(4):1202-1212.

    • Author

    • Inoue T, Tomita H, Ike Y.