• DRAMP ID

    • DRAMP00116
    • Peptide Name

    • Bacteriocin 32 (Bac 32; Bacteriocin)
    • Source

    • Enterococcus faecium (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Not found
    • Sequence

    • FTPSVSFSQNGGVVEAAAQRGYIYKKYPKGAKVPNKVKMLVNIRGKQTMRTCYLMSWTASSRTAKYYYYI
    • Sequence Length

    • 70
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Enterococcus faecium-
        E. hirae-
        E. durans-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00116 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00116.
    • Formula

    • C364H567N97O98S4
    • Absent Amino Acids

    • DH
    • Common Amino Acids

    • KY
    • Mass

    • 7998.34
    • PI

    • 10.11
    • Basic Residues

    • 12
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 20
    • Net Charge

    • +11
    • Boman Index

    • -100.78
    • Hydrophobicity

    • -0.417
    • Aliphatic Index

    • 61.29
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 17420
    • Absorbance 280nm

    • 252.46
    • Polar Residues

    • 28

DRAMP00116

DRAMP00116 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Bac 32, a novel bacteriocin widely disseminated among clinical isolates of Enterococcus faecium.
    • Reference

    • Antimicrob Agents Chemother. 2006 Apr;50(4):1202-1212.
    • Author

    • Inoue T, Tomita H, Ike Y.