General Information

    • DRAMP ID

    • DRAMP00119

    • Peptide Name

    • Listeriocin 743A

    • Source

    • Listeria innocua

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KSYGNGVQCNKKKCWVDWGSAISTIGNNSAANWATGGAAGWKS

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Listeria monocytogenes.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00119 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00119.

Physicochemical Information

    • Formula

    • C195H294N58O60S2

    • Absent Amino Acids

    • EFHLMPR

    • Common Amino Acids

    • G

    • Mass

    • 4474.95

    • PI

    • 9.51

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +4

    • Boman Index

    • -50.25

    • Hydrophobicity

    • -0.556

    • Aliphatic Index

    • 45.58

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 23615

    • Absorbance 280nm

    • 562.26

    • Polar Residues

    • 22

DRAMP00119

DRAMP00119 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification of a new plasmid-encoded sec-dependent bacteriocin produced by Listeria innocua 743.

    • Reference

    • Appl Environ Microbiol. 2001 Sep;67(9):4041-4047.

    • Author

    • Kalmokoff ML, Banerjee SK, Cyr T, Hefford MA, Gleeson T.