• DRAMP ID

    • DRAMP00121
    • Peptide Name

    • Enterocin SE-K4
    • Source

    • Enterococcus faecalis (Streptococcus faecalis)
    • Family

    • Not found
    • Gene

    • orf6
    • Sequence

    • ATYYGNGVYCNKQKCWVDWSRARSEIIDRGVKAYVNGFTKVLGGIGGR
    • Sequence Length

    • 48
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00121 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C239H368N70O67S2
    • Absent Amino Acids

    • HMP
    • Common Amino Acids

    • G
    • Mass

    • 5358.1
    • PI

    • 9.63
    • Basic Residues

    • 8
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +5
    • Boman Index

    • -81.06
    • Hydrophobicity

    • -0.413
    • Aliphatic Index

    • 68.96
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 17085
    • Absorbance 280nm

    • 363.51
    • Polar Residues

    • 21

DRAMP00121

DRAMP00121 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • High production of enterocin SE-K4 from Enterococcus faecalis strain K-4.
    • Reference

    • Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    • Author

    • Doi K, Eguchi T, Iwatake A, Shima J, Ohmomo S, Ogata S.