General Information

    • DRAMP ID

    • DRAMP00121

    • Peptide Name

    • Enterocin SE-K4

    • Source

    • Enterococcus faecalis (Streptococcus faecalis)

    • Family

    • Not found

    • Gene

    • orf6

    • Sequence

    • ATYYGNGVYCNKQKCWVDWSRARSEIIDRGVKAYVNGFTKVLGGIGGR

    • Sequence Length

    • 48

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00121 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00121.

Physicochemical Information

    • Formula

    • C239H368N70O67S2

    • Absent Amino Acids

    • HMP

    • Common Amino Acids

    • G

    • Mass

    • 5358.1

    • PI

    • 9.63

    • Basic Residues

    • 8

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +5

    • Boman Index

    • -81.06

    • Hydrophobicity

    • -0.413

    • Aliphatic Index

    • 68.96

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17085

    • Absorbance 280nm

    • 363.51

    • Polar Residues

    • 21

DRAMP00121

DRAMP00121 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • High production of enterocin SE-K4 from Enterococcus faecalis strain K-4.

    • Reference

    • Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases

    • Author

    • Doi K, Eguchi T, Iwatake A, Shima J, Ohmomo S, Ogata S.