General Information

    • DRAMP ID

    • DRAMP00123

    • Peptide Name

    • Divercin V41 (Bacteriocin)

    • Source

    • Carnobacterium divergens V41

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • TKYYGNGVYCNSKKCWVDWGQASGCIGQTVVGGWLGGAIPGKC

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00123 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00123.

Physicochemical Information

    • Formula

    • C201H300N54O57S4

    • Absent Amino Acids

    • EFHMR

    • Common Amino Acids

    • G

    • Mass

    • 4513.16

    • PI

    • 8.82

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +3

    • Boman Index

    • -11.59

    • Hydrophobicity

    • -0.119

    • Aliphatic Index

    • 58.84

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 21220

    • Absorbance 280nm

    • 505.24

    • Polar Residues

    • 23

DRAMP00123

DRAMP00123 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Divercin V41, a new bacteriocin with two disulfide bonds produced by Carnobacterium divergens V41: primary structure and genetic organization.

    • Reference

    • Microbiology. 1998 Oct;144 ( Pt 10):2837-2844.

    • Author

    • Métivier A, Pilet MF, Dousset X, Sorokine O, Anglade P, Zagorec M, Piard JC, Marion D, Cenatiempo Y, Fremaux C.