General Information

    • DRAMP ID

    • DRAMP00124

    • Peptide Name

    • Coagulin (Bacteriocin)

    • Source

    • Bacillus coagulans I-4

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGTHKC

    • Sequence Length

    • 44

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00124 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C196H298N60O60S5

    • Absent Amino Acids

    • EFLPR

    • Common Amino Acids

    • G

    • Mass

    • 4615.19

    • PI

    • 8.85

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -45.48

    • Hydrophobicity

    • -0.43

    • Aliphatic Index

    • 40

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 14230

    • Absorbance 280nm

    • 330.93

    • Polar Residues

    • 24

DRAMP00124

DRAMP00124 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Biochemical and genetic characterization of coagulin, a new antilisterial bacteriocin in the pediocin family of bacteriocins, produced by Bacillus coagulans I(4).

    • Reference

    • Appl Environ Microbiol. 2000 Dec;66(12):5213-5220.

    • Author

    • Le Marrec C, Hyronimus B, Bressollier P, Verneuil B, Urdaci MC.