• DRAMP ID

    • DRAMP00125
    • Peptide Name

    • Bifidocin B (Bacteriocin)
    • Source

    • Bifidobacterium bifidum
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • KYYGNGVTCGLHDCRVDRGKATCGIINNGGMWGDIG
    • Sequence Length

    • 36
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00125 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00125.
    • Formula

    • C160H250N50O50S4
    • Absent Amino Acids

    • EFPQS
    • Common Amino Acids

    • G
    • Mass

    • 3802.29
    • PI

    • 7.94
    • Basic Residues

    • 5
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +2
    • Boman Index

    • -50.55
    • Hydrophobicity

    • -0.35
    • Aliphatic Index

    • 62.22
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 8605
    • Absorbance 280nm

    • 245.86
    • Polar Residues

    • 19

DRAMP00125

DRAMP00125 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Bacteriocin production by Bifidobacterium spp. A review.
    • Reference

    • Biotechnol Adv. 2013 Jul;31(4):482-488.
    • Author

    • Martinez FA, Balciunas EM, Converti A, Cotter PD, de Souza Oliveira RP.