General Information

    • DRAMP ID

    • DRAMP00131

    • Peptide Name

    • Lactococcin Q beta (Qbeta; Bacteriocin)

    • Source

    • Lactococcus lactis QU 4 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • laqB

    • Sequence

    • KKWGWLAWVEPAGEFLKGFGKGAIKEGNKDKWKNI

    • Sequence Length

    • 35

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Lactococcus lactis subsp. lactis ATCC 19435 (MIC>1000 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00131 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00131.

Physicochemical Information

    • Formula

    • C192H287N49O46

    • Absent Amino Acids

    • CHMQRSTY

    • Common Amino Acids

    • K

    • Mass

    • 4017.69

    • PI

    • 9.78

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +4

    • Boman Index

    • -36.76

    • Hydrophobicity

    • -0.8

    • Aliphatic Index

    • 61.43

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 22000

    • Absorbance 280nm

    • 647.06

    • Polar Residues

    • 8

DRAMP00131

DRAMP00131 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Lactococcin Q, a novel two-peptide bacteriocin produced by Lactococcus lactis QU 4.

    • Reference

    • Appl Environ Microbiol. 2006 May;72(5):3383-3389.

    • Author

    • Zendo T, Koga S, Shigeri Y, Nakayama J, Sonomoto K.