• DRAMP ID

    • DRAMP00136
    • Peptide Name

    • Enterocin E-760 (Bacteriocin)
    • Source

    • Enterococcus sp. (Gram-positive bacteria)
    • Family

    • Belongs to the class IIb bacteriocin
    • Gene

    • Unknow
    • Sequence

    • NRWYCNSAAGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG
    • Sequence Length

    • 62
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-positive bacteria: Listeria monocytogenes 9-72 (MIC=0.1 µg/ml), Staphylococcus epidermidis (MIC=1.6 µg/ml), S. aureus (MIC=1.6 µg/ml), Salmonella enterica serovar Enteritidis 1 (MIC=0.2 µg/ml), S. enterica serovar Enteritidis 4 (MIC=0.4 µg/ml), S. enterica serovar Enteritidis 204 (MIC=0.2 µg/ml), S. enterica serovar Enteritidis 237 (MIC=0.2 µg/ml), S. enterica serovar Choleraesuis 434/4 (MIC=0.4 µg/ml), S. enterica serovar Choleraesuis 370 (MIC=0.4 µg/ml), S. enterica serovar Typhimurium 383/60 (MIC=0.4 µg/ml), S. enterica serovar Typhimurium 320 (MIC=0.2 µg/ml), S. enterica serovar Gallinarum biovar Pullorum (MIC=0.4 µg/ml);
      • Gram-negative bacteria:Escherichia coli HB101 (MIC=0.1 µg/ml), E. coli C600 (MIC=0.1 µg/ml), E. coli O157:H7 Y-63 (MIC=1.6 µg/ml), E. coli O157:H7 G-3 (MIC=1.6 µg/ml), E. coli O157:H7 OD-3 (MIC=1.6 µg/ml), E. coli O157:H7 T-39 (MIC=1.6 µg/ml), Yersinia enterocolitica 03 (MIC=0.1 µg/ml), Y. enterocolitica 09 (MIC=0.1 µg/ml), Y. enterocolitica 04 (MIC=0.1 µg/ml), Y. pseudotuberculosis ser 4 (MIC=3.2 µg/ml), Y. pseudotuberculosis 14 (MIC=3.2 µg/ml), Citrobacter freundii (MIC=1.6 µg/ml), Klebsiella pneumoniae (MIC=3.2 µg/ml), Shigella dysenteriae (MIC=0.1 µg/ml), Campylobacter jejuni L4 (MIC=0.1 µg/ml).
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Formula

    • C269H403N81O80S4
    • Absent Amino Acids

    • DQ
    • Common Amino Acids

    • G
    • Mass

    • 7268.15
    • PI

    • 8.91
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 21
    • Boman Index

    • -42.8
    • Hydrophobicity

    • -17.74
    • Aliphatic Index

    • 47.42
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 19605
    • Absorbance 280nm

    • 321.39
    • Polar Residues

    • 29

DRAMP00136

DRAMP00136 chydropathy plot
    • The enterocin demonstrated thermostability by retaining activity after 5 min at 100 degrees C and was stable at pH values between 5.0 and 8.7. However, activity was lost below pH 3.0 and above pH 9.5.

  • Literature 1
    • Reference

    • Antimicrob Agents Chemother. 2008 Mar;52(3):1094-1100.
    • Author

    • Line JE, Svetoch EA, Eruslanov BV, Perelygin VV, Mitsevich EV, Mitsevich IP, Levchuk VP, Svetoch OE, Seal BS, Siragusa GR, Stern NJ.
    • Title

    • Isolation and purification of enterocin E-760 with broad antimicrobial activity against gram-positive and Gram-negative bacteria.