General Information

    • DRAMP ID

    • DRAMP00140

    • Peptide Name

    • Lactacin-F subunit LafA (Bacteriocin)

    • Source

    • Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • lafA

    • Sequence

    • RNNWQTNVGGAVGSAMIGATVGGTICGPACAVAGAHYLPILWTAVTAATGGFGKIRK

    • Sequence Length

    • 57

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Enterococcus faecalis and other Lactobacilli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00140 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00140.

Physicochemical Information

    • Formula

    • C248H395N73O70S3

    • Absent Amino Acids

    • DE

    • Common Amino Acids

    • GA

    • Mass

    • 5615.49

    • PI

    • 9.85

    • Basic Residues

    • 5

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +5

    • Boman Index

    • 0.69

    • Hydrophobicity

    • 0.432

    • Aliphatic Index

    • 84.04

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 12615

    • Absorbance 280nm

    • 225.27

    • Polar Residues

    • 24

DRAMP00140

DRAMP00140 chydropathy plot

Comments Information

    • Heat stable bacteriocin. peptides for activity

    • lafA and lafX. Associated with a 180 kDa bacteriocin complex.

Literature Information

  • ·Literature 1

    • Title

    • Purification and partial characterization of lactacin F, a bacteriocin produced by Lactobacillus acidophilus 11088.

    • Reference

    • Appl Environ Microbiol. 1991 Jan;57(1):114-121.

    • Author

    • Fremaux C, Ahn C, Klaenhammer TR.
  • ·Literature 2

    • Title

    • The genome sequence of the probiotic intestinal bacterium Lactobacillus johnsonii NCC 533.

    • Reference

    • Proc Natl Acad Sci U S A. 2004 Feb 24;101(8):2512-2517.

    • Author

    • Pridmore RD, Berger B, Desiere F, Vilanova D, Barretto C, Pittet AC, Zwahlen MC, Rouvet M, Altermann E, Barrangou R, Mollet B, Mercenier A, Klaenhammer T, Arigoni F, Schell MA.