General Information

    • DRAMP ID

    • DRAMP00142

    • Peptide Name

    • Gassericin T (gassericin K7 B; Bacteriocin)

    • Source

    • Lactobacillus gasseri LA158 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • gatA

    • Sequence

    • RNNWAANIGGVGGATVAGWALGNAVCGPACGFVGAHYVPIAWAGVTAATGGFGKIRK

    • Sequence Length

    • 57

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00142 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00142.

Physicochemical Information

    • Formula

    • C250H380N74O66S2

    • Absent Amino Acids

    • DEMQS

    • Common Amino Acids

    • GA

    • Mass

    • 5542.34

    • PI

    • 9.85

    • Basic Residues

    • 5

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 27

    • Net Charge

    • +5

    • Boman Index

    • 13.36

    • Hydrophobicity

    • 0.46

    • Aliphatic Index

    • 78.95

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 18115

    • Absorbance 280nm

    • 323.48

    • Polar Residues

    • 23

DRAMP00142

DRAMP00142 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Primary amino acid and DNA sequences of gassericin T, a lactacin F-family bacteriocin produced by Lactobacillus gasseri SBT2055.

    • Reference

    • Biosci Biotechnol Biochem. 2000 Oct;64(10):2201-2208.

    • Author

    • Kawai Y, Saitoh B, Takahashi O, Kitazawa H, Saito T, Nakajima H, Itoh T.