General Information

    • DRAMP ID

    • DRAMP00145

    • Peptide Name

    • Lactocin-705 (Bacteriocin)

    • Source

    • Lactobacillus plantarum (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • Not found

    • Sequence

    • GMSGYIQGIPDFLKGYLHGISAANKHKKGRL

    • Sequence Length

    • 31

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • several lactic acid bacteria, Listeria, Streptococci, etc.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00145 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00145.

Physicochemical Information

    • Formula

    • C152H242N44O40S

    • Absent Amino Acids

    • CETVW

    • Common Amino Acids

    • G

    • Mass

    • 3357.92

    • PI

    • 10

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -30.31

    • Hydrophobicity

    • -0.387

    • Aliphatic Index

    • 81.94

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 99.33

    • Polar Residues

    • 11

DRAMP00145

DRAMP00145 chydropathy plot

Comments Information

    • Potentially useful to control food-borne pathogens in ground meat.

Literature Information

  • ·Literature 1

    • Title

    • Control of Listeria monocytogenes in ground beef by 'Lactocin 705', a bacteriocin produced by Lactobacillus casei CRL 705).

    • Reference

    • Int J Food Microbiol. 1996 Apr;29(2-3):397-402.

    • Author

    • Vignolo G, Fadda S, de Kairuz MN, de Ruiz Holgado AA, Oliver G.