General Information

    • DRAMP ID

    • DRAMP00146

    • Peptide Name

    • Abp118 alpha (Salivaricin CRL1328 alpha peptide)

    • Source

    • Lactobacillus salivarius (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • abp118alpha

    • Sequence

    • KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL

    • Sequence Length

    • 45

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00146 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00146.

Physicochemical Information

    • Formula

    • C181H296N52O50S3

    • Absent Amino Acids

    • DEHQSWY

    • Common Amino Acids

    • G

    • Mass

    • 4096.84

    • PI

    • 8.96

    • Basic Residues

    • 2

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 20

    • Net Charge

    • +2

    • Boman Index

    • 43.4

    • Hydrophobicity

    • 0.88

    • Aliphatic Index

    • 102

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 2.84

    • Polar Residues

    • 19

DRAMP00146

DRAMP00146 chydropathy plot

Comments Information

    • Function

    • Abp118alpha alone exhibits the antimicrobial activity.

Literature Information

  • ·Literature 1

    • Title

    • Characterization of the genetic locus responsible for the production of ABP-118, a novel bacteriocin produced by the probiotic bacterium Lactobacillus salivarius subsp. salivarius UCC118.

    • Reference

    • Microbiology. 2002 Apr;148(Pt 4):973-984.

    • Author

    • Flynn S, van Sinderen D, Thornton GM, Holo H, Nes IF, Collins JK.
  • ·Literature 2

    • Title

    • Characterization of salivaricin CRL 1328, a two-peptide bacteriocin produced by Lactobacillus salivarius CRL 1328 isolated from the human vagina.

    • Reference

    • Res Microbiol. 2009 Jul-Aug;160(6):401-408.

    • Author

    • Vera Pingitore E, Hebert E.M, Nader-Macias M.E, Sesma F.