General Information

    • DRAMP ID

    • DRAMP00148

    • Peptide Name

    • Thermophilin 9 (BlpDst; Bacteriocin)

    • Source

    • Streptococcus thermophilus LMD-9 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • Not found

    • Sequence

    • LSCDEGMLAVGGLGAVGGPWGAAVGVLVGAALYCF

    • Sequence Length

    • 35

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00148 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00148.

Physicochemical Information

    • Formula

    • C148H230N36O42S3

    • Absent Amino Acids

    • HIKNQRT

    • Common Amino Acids

    • G

    • Mass

    • 3281.85

    • PI

    • 3.67

    • Basic Residues

    • 0

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 18

    • Net Charge

    • -2

    • Boman Index

    • 55.27

    • Hydrophobicity

    • 1.294

    • Aliphatic Index

    • 114.29

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 209.26

    • Polar Residues

    • 13

DRAMP00148

DRAMP00148 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • The inhibitory spectrum of thermophilin 9 from Streptococcus thermophilus LMD-9 depends on the production of multiple peptides and the activity of BlpG(St), a thiol-disulfide oxidase.

    • Reference

    • Appl Environ Microbiol. 2008 Feb;74(4):1102-1110.

    • Author

    • Fontaine L, Hols P.