General Information

    • DRAMP ID

    • DRAMP00150

    • Peptide Name

    • Sln2 (chain b of Salivaricin P; Bacteriocin)

    • Source

    • Lactobacillus salivarius DPC6005 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • Not found

    • Sequence

    • KNGYGGSGNRWVHCGAGIVGGALIGAIGGPWSAVAGGISGGFASCH

    • Sequence Length

    • 46

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00150 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00150.

Physicochemical Information

    • Formula

    • C188H284N58O54S2

    • Absent Amino Acids

    • DEMQT

    • Common Amino Acids

    • G

    • Mass

    • 4284.8

    • PI

    • 8.9

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +4

    • Boman Index

    • 15.07

    • Hydrophobicity

    • 0.376

    • Aliphatic Index

    • 74.35

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 12615

    • Absorbance 280nm

    • 280.33

    • Polar Residues

    • 24

DRAMP00150

DRAMP00150 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Salivaricin P, one of a family of two-component antilisterial bacteriocins produced by intestinal isolates of Lactobacillus salivarius.

    • Reference

    • Appl Environ Microbiol. 2007 Jun;73(11):3719-3723.

    • Author

    • Barrett E, Hayes M, O'Connor P, Gardiner G, Fitzgerald GF, Stanton C, Ross RP, Hill C.