General Information

    • DRAMP ID

    • DRAMP00152

    • Peptide Name

    • Enterocin 1071B (Ent1071B; Bacteriocin)

    • Source

    • Enterococcus faecalis BFE 1071 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • Not found

    • Sequence

    • GPGKWLPWLQPAYDFVTGLAKGIGKEGNKNKWKNV

    • Sequence Length

    • 35

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00152 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00152.

Physicochemical Information

    • Formula

    • C184H278N48O46

    • Absent Amino Acids

    • CHMRS

    • Common Amino Acids

    • GK

    • Mass

    • 3898.53

    • PI

    • 9.88

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +4

    • Boman Index

    • -30.01

    • Hydrophobicity

    • -0.731

    • Aliphatic Index

    • 66.86

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17990

    • Absorbance 280nm

    • 529.12

    • Polar Residues

    • 11

DRAMP00152

DRAMP00152 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Biochemical and genetic characterization of the two-peptide bacteriocin enterocin 1071 produced by Enterococcus faecalis FAIR-E 309.

    • Reference

    • Appl Environ Microbiol. 2002 May;68(5):2550-2554.

    • Author

    • Franz CM, Grube A, Herrmann A, Abriouel H, Stärke J, Lombardi A, Tauscher B, Holzapfel WH.