• DRAMP ID

    • DRAMP00153
    • Peptide Name

    • NlmA (chain a of Mutacin IV; Bacteriocin)
    • Source

    • Streptococcus mutans UA140 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIb bacteriocin
    • Gene

    • Not found
    • Sequence

    • KVSGGEAVAAIGICATASAAIGGLAGATLVTPYCVGTWGLIRSH
    • Sequence Length

    • 44
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • Streptococci sanguinis NY101, S. sanguinis ATCC 10556, Streptococcus parasanguinis ATCC 15911, S. oralis TCC 10557, S. mitis ATCC 903, S. mitis ATCC 33399, S. gordonii ATCC 10558, S. crista ATCC 49999, S. sobrinus OMZ176.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00153 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00153.
    • Formula

    • C184H301N51O55S2
    • Absent Amino Acids

    • DFMNQ
    • Common Amino Acids

    • A
    • Mass

    • 4171.84
    • PI

    • 8.06
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 21
    • Net Charge

    • +2
    • Boman Index

    • 26.74
    • Hydrophobicity

    • 0.911
    • Aliphatic Index

    • 108.86
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 7115
    • Absorbance 280nm

    • 165.47
    • Polar Residues

    • 18

DRAMP00153

DRAMP00153 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • The group I strain of Streptococcus mutans, UA140, produces both the lantibiotic mutacin I and a nonlantibiotic bacteriocin, mutacin IV.
    • Reference

    • Appl Environ Microbiol. 2001 Jan;67(1):15-21.
    • Author

    • Qi F, Chen P, Caufield PW.