General Information

    • DRAMP ID

    • DRAMP00155

    • Peptide Name

    • BrcA (chain a of Brochocin C; Bacteriocin)

    • Source

    • Brochothrix campestris ATCC 43754 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • Not found

    • Sequence

    • YSSKDCLKDIGKGIGAGTVAGAAGGGLAAGLGAIPGAFVGAHFGVIGGSAACIGGLLGN

    • Sequence Length

    • 59

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00155 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00155.

Physicochemical Information

    • Formula

    • C231H373N65O70S2

    • Absent Amino Acids

    • EMQRW

    • Common Amino Acids

    • G

    • Mass

    • 5245.02

    • PI

    • 8.03

    • Basic Residues

    • 4

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 26

    • Net Charge

    • +2

    • Boman Index

    • 48.37

    • Hydrophobicity

    • 0.778

    • Aliphatic Index

    • 99.49

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 27.84

    • Polar Residues

    • 26

DRAMP00155

DRAMP00155 chydropathy plot

Comments Information

    • Chain A has an identical sequence to NKR-5-3A from E. faecium NKR-5-3 (Ishbashi N et al 2012 Biosci Biotechnol Biochem 76

    • 947-953).

Literature Information

  • ·Literature 1

    • Title

    • Genetic characterization and heterologous expression of brochocin-C, an antibotulinal, two-peptide bacteriocin produced by Brochothrix campestris ATCC 43754.

    • Reference

    • Appl Environ Microbiol. 1998 Dec;64(12):4757-4766.

    • Author

    • McCormick JK, Poon A, Sailer M, Gao Y, Roy KL, McMullen LM, Vederas JC, Stiles ME, Van Belkum MJ.