General Information

    • DRAMP ID

    • DRAMP00159

    • Peptide Name

    • Lactocin 705beta (lac705beta; chain b of Lactocin 705; Bacteriocin)

    • Source

    • Lactobacillus casei CRL 705 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • Not found

    • Sequence

    • GFWGGLGYIAGRVGAAYGHAQASANNHHSPING

    • Sequence Length

    • 33

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Several lactic acid bacteria, Listeria, Streptococci, etc.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00159 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00159.

Physicochemical Information

    • Formula

    • C147H211N47O42

    • Absent Amino Acids

    • CDEKMT

    • Common Amino Acids

    • G

    • Mass

    • 3308.58

    • PI

    • 8.61

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +4

    • Boman Index

    • -18.95

    • Hydrophobicity

    • -0.224

    • Aliphatic Index

    • 62.42

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8480

    • Absorbance 280nm

    • 265

    • Polar Residues

    • 15

DRAMP00159

DRAMP00159 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification and nucleotide sequence of genes involved in the synthesis of lactocin 705, a two-peptide bacteriocin from Lactobacillus casei CRL 705.

    • Reference

    • FEMS Microbiol Lett. 2000 Apr 15;185(2):157-161.

    • Author

    • Cuozzo SA, Sesma F, Palacios JM, de Ru­z Holgado AP, Raya RR.