General Information

    • DRAMP ID

    • DRAMP00161

    • Peptide Name

    • ThmB (chain b of Thermophilin 13; Bacteriocin)

    • Source

    • Streptococcus thermophilus (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • Not found

    • Sequence

    • QINWGSVVGHCIGGAIIGGAFSGGAAAGVGCLVGSGKAIINGL

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Streptococcus thermophilus SFi3, Clostridium botulinum, Listeria monocytogenes, Bacillus cereus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00161 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00161.

Physicochemical Information

    • Formula

    • C172H278N50O50S2

    • Absent Amino Acids

    • DEMPRTY

    • Common Amino Acids

    • G

    • Mass

    • 3910.52

    • PI

    • 8.07

    • Basic Residues

    • 2

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 20

    • Net Charge

    • +2

    • Boman Index

    • 47.24

    • Hydrophobicity

    • 1.021

    • Aliphatic Index

    • 113.49

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 133.93

    • Polar Residues

    • 20

DRAMP00161

DRAMP00161 chydropathy plot

Comments Information

    • ThmB, by itself, is not bactericidal. An equal amount of ThmB can increase the activity of ThmA by 40 fold, however, an excess of ThmB inhibits the activity of ThmA. Disulfide bonds are not required for activity.

Literature Information

  • ·Literature 1

    • Title

    • Thermophilin 13, a nontypical antilisterial poration complex bacteriocin, that functions without a receptor.

    • Reference

    • J Biol Chem. 1997 May 30;272(22):14277-14284.

    • Author

    • Marciset O, Jeronimus-Stratingh MC, Mollet B, Poolman B.