General Information

    • DRAMP ID

    • DRAMP00164

    • Peptide Name

    • Bacteriocin uberolysin (Bacteriocin)

    • Source

    • Streptococcus uberis strain 42 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • ublA

    • Sequence

    • LAGYTGIASGTAKKVVDAIDKGAAAFVIISIISTVISAGALGAVSASADFIILTVKNYISRNLKAQAVIW

    • Sequence Length

    • 70

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Most streptococci (except S.rattus and S. mutans), Listeria spp., enterococci and staphylococci.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00164 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00164.

Physicochemical Information

    • Formula

    • C324H534N82O93

    • Absent Amino Acids

    • CEHMP

    • Common Amino Acids

    • A

    • Mass

    • 7066.3

    • PI

    • 9.6

    • Basic Residues

    • 6

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 39

    • Net Charge

    • +3

    • Boman Index

    • 19.34

    • Hydrophobicity

    • 0.937

    • Aliphatic Index

    • 132.57

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8480

    • Absorbance 280nm

    • 122.9

    • Polar Residues

    • 21

DRAMP00164

DRAMP00164 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Uberolysin: a novel cyclic bacteriocin produced by Streptococcus uberis.

    • Reference

    • Microbiology. 2007 May;153(Pt 5):1619-1630.

    • Author

    • Wirawan RE, Swanson KM, Kleffmann T, Jack RW, Tagg JR.