General Information

    • DRAMP ID

    • DRAMP00165

    • Peptide Name

    • Gassericin A (GaaA; Bacteriocin)

    • Source

    • Lactobacillus gasseri LA39 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • gaaA

    • Sequence

    • IYWIADQFGIHLATGTARKLLDAMASGASLGTAFAAILGVTLPAWALAAAGALGATAA

    • Sequence Length

    • 58

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: L. reuteri LA6.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00165 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00165.

Physicochemical Information

    • Formula

    • C261H411N67O72S

    • Absent Amino Acids

    • CEN

    • Common Amino Acids

    • A

    • Mass

    • 5671.6

    • PI

    • 6.75

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 35

    • Net Charge

    • +1

    • Boman Index

    • 47.31

    • Hydrophobicity

    • 0.997

    • Aliphatic Index

    • 116.72

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 219.12

    • Polar Residues

    • 15

DRAMP00165

DRAMP00165 chydropathy plot

Comments Information

    • It causes K+ ion efflux from indicator cells and liposome.Circularized by forming a peptide bond between the N- and C-ends. Initially, it was thought to differ from Reutericin 6 only by the number of D-amino acids (Kawai et al., 2004). A re-study corrected this and concluded that gassericin A and reutericin 6 are identical bacteriocins (Arakawa et al. 2010 Lett Appl. Microbiol 50

    • 406-411). However, reutericin 6 was isolated from Lactobacillus reuteri LA6.

Literature Information

  • ·Literature 1

    • Title

    • Sequence analysis by cloning of the structural gene of gassericin A, a hydrophobic bacteriocin produced by Lactobacillus gasseri LA39.

    • Reference

    • Biosci Biotechnol Biochem. 1998 May;62(5):887-892.

    • Author

    • Kawai Y, Saito T, Suzuki M, Itoh T.
  • ·Literature 2

    • Title

    • Conjugative plasmid from Lactobacillus gasseri LA39 that carries genes for production of and immunity to the circular bacteriocin gassericin A.

    • Reference

    • Appl Environ Microbiol. 2009 Oct;75(19):6340-6351.

    • Author

    • Ito Y, Kawai Y, Arakawa K, Honme Y, Sasaki T, Saito T.