General Information

    • DRAMP ID

    • DRAMP00166

    • Peptide Name

    • Butyrivibriocin AR10 (Bacteriocin)

    • Source

    • Butyrivibrium fibrisolvens AR10 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • bviA

    • Sequence

    • IYFIADKMGIQLAPAWYQDIVNWVSAGGTLTTGFAIIVGVTVPAWIAEAAAAFGIASA

    • Sequence Length

    • 58

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Clostridium clostridiforme ATCC25537, C. perfringens, Eubacterium ruminentium ATCC17233, Lachnospira multiperus ATCC19207, L. vitulinus ATCC27783, Lactobacillus ruminis ATCC27780, Ruminococcus albus SY3, Streptococcus bovis ATCC33317, Listeria ivanovii 80, L. gray 83.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00166 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00166.

Physicochemical Information

    • Formula

    • C284H427N65O76S

    • Absent Amino Acids

    • CHR

    • Common Amino Acids

    • A

    • Mass

    • 5999.96

    • PI

    • 4.03

    • Basic Residues

    • 1

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 34

    • Net Charge

    • -2

    • Boman Index

    • 51.97

    • Hydrophobicity

    • 1.002

    • Aliphatic Index

    • 114.66

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 19480

    • Absorbance 280nm

    • 341.75

    • Polar Residues

    • 15

DRAMP00166

DRAMP00166 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of a bacteriocin (Butyrivibriocin AR10) from the ruminal anaerobe Butyrivibrio fibrisolvens AR10: evidence in support of the widespread occurrence of bacteriocin-like activity among ruminal isolates of B. fibrisolvens.

    • Reference

    • Appl Environ Microbiol. 1997 Feb;63(2):394-402.

    • Author

    • Kalmokoff ML, Teather RM.
  • ·Literature 2

    • Title

    • Butyrivibriocin AR10, a new cyclic bacteriocin produced by the ruminal anaerobe Butyrivibrio fibrisolvens AR10: characterization of the gene and peptide.

    • Reference

    • Can J Microbiol. 2003 Dec;49(12):763-773.

    • Author

    • Kalmokoff ML, Cyr TD, Hefford MA, Whitford MF, Teather RM.