General Information

    • DRAMP ID

    • DRAMP00168

    • Peptide Name

    • Divergicin A (Bacteriocin)

    • Source

    • Carnobacterium divergens (Gram-positive bacteria)

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • Not found

    • Sequence

    • AAPKITQKQKNCVNGQLGGMLAGALGGPGGVVLGGIGGAIAGGCFN

    • Sequence Length

    • 46

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00168 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00168.

Physicochemical Information

    • Formula

    • C182H305N55O54S3

    • Absent Amino Acids

    • DEHRSWY

    • Common Amino Acids

    • G

    • Mass

    • 4223.94

    • PI

    • 9.39

    • Basic Residues

    • 3

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +3

    • Boman Index

    • 22.71

    • Hydrophobicity

    • 0.426

    • Aliphatic Index

    • 91.3

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 2.78

    • Polar Residues

    • 20

DRAMP00168

DRAMP00168 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A signal peptide secretion-dependent bacteriocin from Carnobacterium divergens.

    • Reference

    • J Bacteriol. 1995 Jun;177(11):3143-3149.

    • Author

    • Worobo RW, Van Belkum MJ, Sailer M, Roy KL, Vederas JC, Stiles ME.
  • ·Literature 2

    • Title

    • Characterization of the theta-type plasmid pCD3.4 from Carnobacterium divergens, and modulation of its host range by RepA mutation.

    • Reference

    • Microbiology. 2006 Jan;152(Pt 1):171-178.

    • Author

    • van Belkum MJ, Stiles ME.