• DRAMP ID

    • DRAMP00171
    • Peptide Name

    • Lactocyclicin Q (Bacteriocin)
    • Source

    • Lactococcus sp. strain QU 12 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIc bacteriocin
    • Gene

    • lycQ
    • Sequence

    • LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW
    • Sequence Length

    • 61
    • Evidence code

    • Predicted
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-positive bacteria: Lactococcus sp.strain QU 12 (MIC=34.3 µM), Lactococcus lactis subsp.lactis JCM 7638 (MIC=0.141 µM), L. lactis subsp.lactis ATCC 19435 (MIC=0.141 µM), L. lactis subsp.lactis IL1403 (MIC=0.141 µM), L. lactis QU 1 (MIC=0.141 µM), L. lactis subsp.cremoris ATCC 19275 (MIC=0.283 µM), Lactococcus raffinolactis JCM 5706 (MIC=0.71 µM), Lactobacillus sakei subsp.sakei JCM 1157 (MIC=0.015 µM), Lactobacillus casei subsp.casei JCM 1134 (MIC=2.27 µM), Leuconostoc brevis JCM 1059 (MIC=1.14 µM), L. acidophilus JCM 1132 (MIC=2.86 µM), L. coryniformis subsp.coryniformis JCM 1164 (MIC=2.86 µM), L. kimchii JCM 10707 (MIC=0.71 µM), L. mesenteroides subsp.mesenteroides JCM 6124 (MIC=1.03 µM), Weissella cibaria JCM 12495 (MIC=0.71 µM), Pediococcus pentosaceus JCM 5885 (MIC=0.55 µM), P. pentosaceus JCM 5890 (MIC=2.86 µM), P. acidilactici JCM 8797 (MIC=2.86 µM), P. dextrinicus JCM 5887 (MIC=0.141 µM), Enterococcus faecium JCM5804 (MIC=0.71 µM), E. hirae ATCC 10541 (MIC=0.71 µM), E. durans NBRC 100479 (MIC=0.71 µM), E. faecalis JCM 5803 (MIC=0.26 µM), Streptococcus salivarius JCM 5707 (MIC=22.9 µM), S. bovis JCM 5802 (MIC=22.9 µM), Bacillus coagulans JCM 2257 (MIC=0.015 µM), B. circulans JCM 2504 (MIC=0.031 µM), B. subtilis JCM 1465 (MIC=0.064 µM), B. cereus JCM 2152 (MIC=11.4 µM), Micrococcus luteus IFO 12708 (MIC=5.7 µM), Listeria innocua ATCC 33090 (MIC=1.03 µM), L. monocytogenes ATCC BAA-679 (MIC=1.03 µM), Staphylococcus aureus subsp.aureus ATCC 12600 (MIC=91.6 µM); Gram-negative bacteria: Escherichia coli JM109 (MIC=34.3 µM), E. coli NBRC 3301 (MIC=17.3 µM).
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00171 helical wheel diagram
    • Formula

    • C284H449N77O71
    • Absent Amino Acids

    • CEFMY
    • Common Amino Acids

    • A
    • Mass

    • 7148.67
    • PI

    • 10.5
    • Basic Residues

    • 6
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 38
    • Boman Index

    • 45.98
    • Hydrophobicity

    • 82.62
    • Aliphatic Index

    • 126.72
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 22000
    • Absorbance 280nm

    • 366.67
    • Polar Residues

    • 11
browser doesn't support html5

Amino Acid Distribution

DRAMP00171 chydropathy plot
    • No comments found on DRAMP database

  • Literature 1
    • Reference

    • Appl Environ Microbiol. 2009 Mar;75(6):1552-1558.
    • Author

    • Sawa N, Zendo T, Kiyofuji J, Fujita K, Himeno K, Nakayama J, Sonomoto K.
    • Title

    • Identification and characterization of lactocyclicin Q, a novel cyclic bacteriocin produced by Lactococcus sp. strain QU 12.
  • Literature 2
    • Reference

    • Appl Environ Microbiol. 2011 Nov;77(22):8164-8170.
    • Author

    • Masuda Y, Ono H, Kitagawa H, Ito H, Mu F, Sawa N, Zendo T, Sonomoto K.
    • Title

    • Identification and characterization of leucocyclicin Q, a novel cyclic bacteriocin produced by Leuconostoc mesenteroides TK41401.