• • DRAMP ID

  • DRAMP00172

• • Peptide Name

  • Garvicin ML (Bacteriocin)

• • Source

  • Lactococcus garvieae DCC43 (Gram-positive bacteria)

• • Family

  • Belongs to the class IIc bacteriocin

• • Gene

  • garML

• • Sequence

  • LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA

• • Sequence Length

  • 60

• • UniProt Entry

  • D2KC49

• • Protein Existence

  • Predicted

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+

• • Target Organism

  • • Gram-positive bacteria: Lactobacillus reuteri 20016 (378), L. helveticus 15009 (492), L. curvatus 2739 (177), L. casei 334 (1-174), L. acidophilus 4356 (236), L. sakei 2714 (1-445), Lactococcus lactis BB24 (928), L. lactis NZ9000 (163), L. lactis DPC5598 (1-541)，L. garvieae 5274 (617), L. garvieae 5806 (2-807), L. garvieae 5807 (2-705), L. raffinolactis 988 (228), Pediococcus acidilactici 347 (1-398), P. pentosaceus FBB61 (1-131), Enterococcus faecium P13 (1-291), E. faecium L50 (719), E. faecialis DBH18 (25), E. faecalis P4 (123), Propionibacterium sp.P6 (190), P. acidipropionici 563 (864), Clostridium tyrobutiricum 3.5CT (651), C. tyrobutiricum 1754 (839), C. perfringens 376 (352), C. botulinum 551 (574), Listeria monocytogenes 4032 (662), L. ivanovii 913 (1-020), L. seeligeri 917 (684), L. grayi 931 (742), L. welshimeri 919 (452), Brochothrix thermosphacta 847 (283), Streptococcus pneumoniae FQ26 (590), S. pneumoniae 67620 (596), S. pneumoniae 15M-1047 (790).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • No specific N-terminal

• • C-terminal Modification

  • No specific C-terminal

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00172.

DRAMP00172

• • The peptide is expressed as a 63mer precursor. The leader sequence was removed and covalent link of the N and C-termini leading to the mature peptide. This bacteriocin inhibits other Gram-positive bacteria. The cyclic structure of the peptide confers stability to heat (80-100oC), pH (2-10) and proteases (trypsin, pepsin, papain and proteinase K).

• ·Literature 1

• • Title

  • Characterization of Garvicin ML, a Novel Circular Bacteriocin Produced by Lactococcus garvieae DCC43, Isolated from Mallard Ducks (Anas platyrhynchos).

• • Pubmed ID

  • 21057028

• • Reference

  • Appl Environ Microbiol. 2011 Jan;77(1):369-373.

• • Author

  • Borrero J, Brede DA, Skaugen M, Diep DB, Herranz C, Nes IF, Cintas LM, Hern¡ndez PE.