• • DRAMP ID

  • DRAMP00173

• • Peptide Name

  • Leucocyclicin Q (Bacteriocin)

• • Source

  • Leuconostoc mesenteroides TK41401 (Gram-positive bacteria)

• • Family

  • Belongs to the class IIc bacteriocin

• • Gene

  • lcyQ

• • Sequence

  • LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIVKHEGKAAAIAW

• • Sequence Length

  • 61

• • UniProt Entry

  • G5ELQ0

• • Protein Existence

  • Predicted

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+

• • Target Organism

  • • Gram-positive bacteria: Lactococcus lactis ssp. lactis JCM 7638 (MIC=0.038 µM), L. lactis ssp. lactis ATCC 19435 (MIC=0.038 µM), L. sp. QU 12 (MIC=1.203 µM), Lactobacillus sakei ssp. sakei JCM 1157 (MIC=0.038 µM), Weissella cibaria JCM 12495 (MIC=2.405 µM), W. paramesenteroides JCM 9890 (MIC=0.075 µM), Pediococcus pentosaceus JCM 5885 (MIC=2.405 µM), P. dextrinicus JCM 5887 (MIC=0.038 µM), Enterococcus faecium JCM 5804 (MIC=0.038 µM), E. faecalis JCM 5803 (MIC=0.15 µM), Streptococcus salivarius JCM 5707 (MIC=2.405 µM), S. bovis JCM 5802 (MIC=0.601 µM), S. mutans JCM 5705 (MIC=19.25 µM), Bacillus coagulans JCM 2257 (MIC=0.075 µM), B. subtilis ssp. subtilis JCM 1465 (MIC=0.601 µM), B. cereus JCM 2152 (MIC=2.405 µM), Kocuria rhizophila NBRC 12708 (MIC=9.623 µM), Listeria innocua ATCC 33090 (MIC=0.601 µM), Leuconostoc mesenteroides ssp. mes. JCM 6124 (MIC=0.3 µM), Escherichia coli JM109 (MIC=38.49 µM), E. coli NBRC 3301 (MIC=38.49 µM)

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Cyclization (N termini to C termini)

• • C-terminal Modification

  • Cyclization (C termini to N termini)

• • Nonterminal Modifications and Unusual Amino Acids

  • The whole peptide has a cyclic structure in which N and C termini are bound to each other.

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP00173_predicted_structure.pdb to download.

DRAMP00173

• • Function

  • This precursor showed high similarity to the precursor of lactocyclicin Q, a cyclic bacteriocin produced by Lactococcus sp. strain QU 12. This is the first report of a cyclic bacteriocin produced by a strain of the genus Leuconostoc.

• ·Literature 1

• • Title

  • Identification and characterization of leucocyclicin Q, a novel cyclic bacteriocin produced by Leuconostoc mesenteroides TK41401.

• • Pubmed ID

  • 21948835

• • Reference

  • Appl Environ Microbiol. 2011 Nov;77(22):8164-8170.

• • Author

  • Masuda Y, Ono H, Kitagawa H, Ito H, Mu F, Sawa N, Zendo T, Sonomoto K.