• DRAMP ID

    • DRAMP00173
    • Peptide Name

    • Leucocyclicin Q (Bacteriocin)
    • Source

    • Leuconostoc mesenteroides TK41401 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIc bacteriocin
    • Gene

    • lcyQ
    • Sequence

    • LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIVKHEGKAAAIAW
    • Sequence Length

    • 61
    • Evidence code

    • Predicted
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-positive bacteria: Lactococcus lactis ssp. lactis JCM 7638 (MIC=0.038 µM), L. lactis ssp. lactis ATCC 19435 (MIC=0.038 µM), L. sp. QU 12 (MIC=1.203 µM), Lactobacillus sakei ssp. sakei JCM 1157 (MIC=0.038 µM), Weissella cibaria JCM 12495 (MIC=2.405 µM), W. paramesenteroides JCM 9890 (MIC=0.075 µM), Pediococcus pentosaceus JCM 5885 (MIC=2.405 µM), P. dextrinicus JCM 5887 (MIC=0.038 µM), Enterococcus faecium JCM 5804 (MIC=0.038 µM), E. faecalis JCM 5803 (MIC=0.15 µM), Streptococcus salivarius JCM 5707 (MIC=2.405 µM), S. bovis JCM 5802 (MIC=0.601 µM), S. mutans JCM 5705 (MIC=19.25 µM), Bacillus coagulans JCM 2257 (MIC=0.075 µM), B. subtilis ssp. subtilis JCM 1465 (MIC=0.601 µM), B. cereus JCM 2152 (MIC=2.405 µM), Kocuria rhizophila NBRC 12708 (MIC=9.623 µM), Listeria innocua ATCC 33090 (MIC=0.601 µM), Leuconostoc mesenteroides ssp. mes. JCM 6124 (MIC=0.3 µM), Escherichia coli JM109 (MIC=38.49 µM), E. coli NBRC 3301 (MIC=38.49 µM)
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Formula

    • C282H460N74O77
    • Absent Amino Acids

    • CDFMRY
    • Common Amino Acids

    • A
    • Mass

    • 7189.68
    • PI

    • 10.33
    • Basic Residues

    • 5
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 35
    • Boman Index

    • 35.71
    • Hydrophobicity

    • 75.08
    • Aliphatic Index

    • 129.84
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 16500
    • Absorbance 280nm

    • 275
    • Polar Residues

    • 16

DRAMP00173

DRAMP00173 chydropathy plot
    • This precursor showed high similarity to the precursor of lactocyclicin Q, a cyclic bacteriocin produced by Lactococcus sp. strain QU 12. This is the first report of a cyclic bacteriocin produced by a strain of the genus Leuconostoc.

  • Literature 1
    • Reference

    • Appl Environ Microbiol. 2011 Nov;77(22):8164-8170.
    • Author

    • Masuda Y, Ono H, Kitagawa H, Ito H, Mu F, Sawa N, Zendo T, Sonomoto K.
    • Title

    • Identification and characterization of leucocyclicin Q, a novel cyclic bacteriocin produced by Leuconostoc mesenteroides TK41401.