• DRAMP ID

    • DRAMP00177
    • Peptide Name

    • Enterocin B (EntB; Bacteriocin)
    • Source

    • Enterococcus faecium T136 (Gram-positive bacteria)
    • Family

    • Belongs to the class IId bacteriocin
    • Gene

    • entB
    • Sequence

    • ENDHRMPNNLNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN
    • Sequence Length

    • 53
    • Evidence code

    • Predicted
    • Biological Activity

    • Antibacterial
    • Target Organism

      • Gram-positive bacteria: Enterococcus faecalis JCM 5803 (MIC=86.9 nM), Enterococcus faecalis OU510 (MIC=174 nM), E. faecium TUA 1344L (MIC=43.4 nM), E. hirae ATCC 10541 (MIC=5.44 nM), Lactobacillus plantarum ATCC 14917 (MIC=86.9 nM), L. sakei ssp. sakei JCM 1157 (MIC=5.44 nM), Bacillus coagulans JCM 2257 (MIC=89000 nM), Bacillus subtilis JCM 1465 (MIC=44500 nM).
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00177 helical wheel diagram
    • Formula

    • C236H376N74O69S3
    • Absent Amino Acids

    • QT
    • Common Amino Acids

    • AGN
    • Mass

    • 6377.95
    • PI

    • 10.05
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 18
    • Boman Index

    • -61.59
    • Hydrophobicity

    • -37.55
    • Aliphatic Index

    • 72.08
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7115
    • Absorbance 280nm

    • 136.83
    • Polar Residues

    • 21

DRAMP00177

DRAMP00177 chydropathy plot
    • No comments found on DRAMP database

  • Literature 1
    • Reference

    • Appl Environ Microbiol. 1999 May;65(5):2170-2178.
    • Author

    • Franz CM, Worobo RW, Quadri LE, Schillinger U, Holzapfel WH, Vederas JC, Stiles ME.
    • Title

    • Atypical genetic locus associated with constitutive production of enterocin B by Enterococcus faecium BFE 900.
  • Literature 2
    • Reference

    • Microbiology. 1997 Jul;143 (Pt 7):2287-2294.
    • Author

    • Casaus P, Nilsen T, Cintas LM, Nes IF, Hern┬índez PE, Holo H.
    • Title

    • Enterocin B, a new bacteriocin from Enterococcus faecium T136 which can act synergistically with enterocin A.