General Information

    • DRAMP ID

    • DRAMP00180

    • Peptide Name

    • Lactococcin-B (LCN-B; Bacteriocin)

    • Source

    • Lactococcus lactis subsp (Streptococcus cremoris) (Gram-positive bacteria)

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • lcnB

    • Sequence

    • SLQYVMSAGPYTWYKDTRTGKTICKQTIDTASYTFGVMAEGWGKTFH

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Lactococcus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00180 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00180.

Physicochemical Information

    • Formula

    • C241H358N60O71S3

    • Absent Amino Acids

    • N

    • Common Amino Acids

    • T

    • Mass

    • 5328.03

    • PI

    • 8.89

    • Basic Residues

    • 6

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +3

    • Boman Index

    • -58.86

    • Hydrophobicity

    • -0.445

    • Aliphatic Index

    • 43.62

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 16960

    • Absorbance 280nm

    • 368.7

    • Polar Residues

    • 21

DRAMP00180

DRAMP00180 chydropathy plot

Comments Information

    • MOA

    • Kills Lactococci by dissipating the membrane potential of the cells.

Literature Information

  • ·Literature 1

    • Title

    • Cloning, sequencing, and expression in Escherichia coli of lcnB, a third bacteriocin determinant from the lactococcal bacteriocin plasmid p9B4-6.

    • Reference

    • Appl Environ Microbiol. 1992 Feb;58(2):572-577.

    • Author

    • van Belkum MJ, Kok J, Venema G.
  • ·Literature 2

    • Title

    • Mutational analysis and chemical modification of Cys24 of lactococcin B, a bacteriocin produced by Lactococcus lactis.

    • Reference

    • Microbiology. 1996 Oct;142 (Pt 10):2825-2830.

    • Author

    • Venema K, Dost MH, Venema G, Kok J.