General Information

    • DRAMP ID

    • DRAMP00184

    • Peptide Name

    • Lactococcin 972 (Lcn972; homodimer; Bacteriocin)

    • Source

    • Lactococcus lactis subsp. lactis IPLA 972 (Streptococcus lactis) (Gram-positive bacteria)

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • lcn972

    • Sequence

    • EGTWQHGYGVSSAYSNYHHGSKTHSATVVNNNTGRQGKDTQRAGVWAKATVGRNLTEKASFYYNFW

    • Sequence Length

    • 66

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Lactococcus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid II

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Beta strand (6 strands; 45 residues)

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00184 helical wheel diagram

    • PDB ID

    • 2LGN resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00184.

Physicochemical Information

    • Formula

    • C326H475N99O100

    • Absent Amino Acids

    • CIMP

    • Common Amino Acids

    • GT

    • Mass

    • 7380.96

    • PI

    • 9.7

    • Basic Residues

    • 11

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +8

    • Boman Index

    • -147.04

    • Hydrophobicity

    • -0.982

    • Aliphatic Index

    • 36.97

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 23950

    • Absorbance 280nm

    • 368.46

    • Polar Residues

    • 32

DRAMP00184

DRAMP00184 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Synthesis of lactococcin 972, a bacteriocin produced by Lactococcus lactis IPLA 972, depends on the expression of a plasmid-encoded bicistronic operon.

    • Reference

    • Microbiology. 1999 Nov;145 (Pt 11):3155-3161.

    • Author

    • Mart­nez B, Fern¡ndez M, Su¡rez JE, Rodr­guez A.
  • ·Literature 2

    • Title

    • Lactococcin 972: a homodimeric lactococcal bacteriocin whose primary target is not the plasma membrane.

    • Reference

    • Microbiology. 1996 Sep;142 (Pt 9):2393-2398.

    • Author

    • Mart­nez B, Su¡rez JE, Rodr­guez A.
  • ·Literature 3

    • Title

    • Structure and properties of lactococcin 972 from Lactococcus lactis.

    • Reference

    • Submitted (JUL-2011) to the PDB data bank.

    • Author

    • Turner D.L, Lamosa P, Martinez B.