General Information

    • DRAMP ID

    • DRAMP00188

    • Peptide Name

    • Enterocin RJ-11 (EntRJ-11; Bacteriocin)

    • Source

    • Enterococcus faecalis RJ-11 (Gram-positive bacteria)

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • Not found

    • Sequence

    • APAGLVAKFGRPIVKKYYKQIMQFIGEGSAINKIIPWIARMWRT

    • Sequence Length

    • 44

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Enterococcus faecalis RJ-11, Enterococcus sp. strain RB-3, Enterococcus sp. strain RJ-10, Enterococcus sp. strain SJ-16, Enterococcus sp. strain YJ-35, Enterococcus durans KB-60, Lactococcus lactis IFO12007, Leuconostoc mesenteroides IFO3426, Bacillus subtilis JCM1465, Bacillus amyloliquefaciens B1, Bacillus cereus B3, Listeria monocytogenes SUB635, Staphylococcus aureus SUB511.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00188 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C238H377N63O54S2

    • Absent Amino Acids

    • CDH

    • Common Amino Acids

    • I

    • Mass

    • 5049.12

    • PI

    • 10.71

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +7

    • Boman Index

    • -27.72

    • Hydrophobicity

    • 0.064

    • Aliphatic Index

    • 95.45

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 13980

    • Absorbance 280nm

    • 325.12

    • Polar Residues

    • 9

DRAMP00188

DRAMP00188 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of a novel bacteriocin produced by Enterococcus faecalis strain RJ-11.

    • Reference

    • Appl Environ Microbiol. 2003 Oct;69(10):5746-5753.

    • Author

    • Yamamoto Y, Togawa Y, Shimosaka M, Okazaki M.