• DRAMP ID

    • DRAMP00189
    • Peptide Name

    • Leucocin Q (Bacteriocin)
    • Source

    • Leuconostoc pseudomesenteroides QU 15 (Gram-positive bacteria)
    • Family

    • Belongs to the class IId bacteriocin
    • Gene

    • LccQ
    • Sequence

    • KGLGKLIGIDWLLGQAKDAVKQYKKDYKRWH
    • Sequence Length

    • 31
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknown
    • Biological Activity

    • Antibacterial, Anti-Gram+, Antimicrobial
    • Target Organism

      • Gram-positive bacteria: Bacillus circulans JCM 2504T (MIC=4.10 µmol/L), Listeria innocua ATCC 33090 (MIC=0.03 µmol/L), Listeria monocytogenes ATCC BAA-679 (MIC=1.03 µmol/L), Enterococcus faecalis JCM 5803 (MIC=4.10 µmol/L), Lactobacillus plantarum ATCC 14917 (MIC=4.10 µmol/L), Lactobacillus sakei ssp. sakei JCM 1157 (MIC=1.04 µmol/L), Leuconostoc mesenteroides ssp. mesenteroides JCM 6124 (MIC=4.10 µmol/L).
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Formula

    • C171H271N47O42
    • Absent Amino Acids

    • CEFMNPST
    • Common Amino Acids

    • K
    • Mass

    • 4192.65
    • PI

    • 10.55
    • Basic Residues

    • 9
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 11
    • Boman Index

    • -50.35
    • Hydrophobicity

    • -85.48
    • Aliphatic Index

    • 91.29
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 13980
    • Absorbance 280nm

    • 466
    • Polar Residues

    • 6

DRAMP00189

DRAMP00189 chydropathy plot
    • Leuc.pseudomesenteroides QU 15 (isolated from Nukadoko) produce at least three bacteriocins, leucocin A, and two novel bacteriocins termed leucocin Q and leucocin

  • Literature 1
    • Reference

    • J Appl Microbiol. 2010 Jul;109(1):282-291.
    • Author

    • Sawa N, Okamura K, Zendo T, Himeno K, Nakayama J, Sonomoto K.
    • Title

    • Identification and characterization of novel multiple bacteriocins produced by Leuconostoc pseudomesenteroides QU 15.