General Information

    • DRAMP ID

    • DRAMP00189

    • Peptide Name

    • Leucocin Q (Bacteriocin)

    • Source

    • Leuconostoc pseudomesenteroides QU 15 (Gram-positive bacteria)

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • LccQ

    • Sequence

    • KGLGKLIGIDWLLGQAKDAVKQYKKDYKRWH

    • Sequence Length

    • 31

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Bacillus circulans JCM 2504T (MIC=4.10 µmol/L), Listeria innocua ATCC 33090 (MIC=0.03 µmol/L), Listeria monocytogenes ATCC BAA-679 (MIC=1.03 µmol/L), Enterococcus faecalis JCM 5803 (MIC=4.10 µmol/L), Lactobacillus plantarum ATCC 14917 (MIC=4.10 µmol/L), Lactobacillus sakei ssp. sakei JCM 1157 (MIC=1.04 µmol/L), Leuconostoc mesenteroides ssp. mesenteroides JCM 6124 (MIC=4.10 µmol/L).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00189 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00189.

Physicochemical Information

    • Formula

    • C171H271N47O42

    • Absent Amino Acids

    • CEFMNPST

    • Common Amino Acids

    • K

    • Mass

    • 3657.32

    • PI

    • 9.9

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +6

    • Boman Index

    • -50.35

    • Hydrophobicity

    • -0.855

    • Aliphatic Index

    • 91.29

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 13980

    • Absorbance 280nm

    • 466

    • Polar Residues

    • 6

DRAMP00189

DRAMP00189 chydropathy plot

Comments Information

    • Function

    • Leuc.pseudomesenteroides QU 15 (isolated from Nukadoko) produce at least three bacteriocins, leucocin A, and two novel bacteriocins termed leucocin Q and leucocin

Literature Information

  • ·Literature 1

    • Title

    • Identification and characterization of novel multiple bacteriocins produced by Leuconostoc pseudomesenteroides QU 15.

    • Reference

    • J Appl Microbiol. 2010 Jul;109(1):282-291.

    • Author

    • Sawa N, Okamura K, Zendo T, Himeno K, Nakayama J, Sonomoto K.