General Information

    • DRAMP ID

    • DRAMP00190

    • Peptide Name

    • Leucocin N (Bacteriocin)

    • Source

    • Leuconostoc pseudomesenteroides QU 15 (Gram-positive bacteria)

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • LccN

    • Sequence

    • MNKEYNSISNFKKITNKDLQNINGGFIGRAIGDFVYFGAKGLRESGKLLNYYYKHKH

    • Sequence Length

    • 57

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Bacillus circulans JCM 2504T (MIC=5.20 µmol/L), Listeria innocua ATCC 33090 (MIC=1.30 µmol/L), Listeria monocytogenes ATCC BAA-679 (MIC=1.30 µmol/L), Enterococcus faecalis JCM 5803 (MIC=5.20 µmol/L), Lactobacillus plantarum ATCC 14917 (MIC=2.60 µmol/L), Lactobacillus sakei ssp. sakei JCM 1157 (MIC=1.30 µmol/L), Leuconostoc mesenteroides ssp. mesenteroides JCM 6124 (MIC=2.60 µmol/L).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00190 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C301H461N83O83S

    • Absent Amino Acids

    • CPW

    • Common Amino Acids

    • KGN

    • Mass

    • 6602.54

    • PI

    • 9.79

    • Basic Residues

    • 12

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +8

    • Boman Index

    • -107.32

    • Hydrophobicity

    • -0.744

    • Aliphatic Index

    • 70.18

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7450

    • Absorbance 280nm

    • 133.04

    • Polar Residues

    • 23

DRAMP00190

DRAMP00190 chydropathy plot

Comments Information

    • Function

    • Leuc.pseudomesenteroides QU 15 (isolated from Nukadoko) produce at least three bacteriocins, leucocin A, and two novel bacteriocins termed leucocin Q and leucocin N.

Literature Information

  • ·Literature 1

    • Title

    • Identification and characterization of novel multiple bacteriocins produced by Leuconostoc pseudomesenteroides QU 15.

    • Reference

    • J Appl Microbiol. 2010 Jul;109(1):282-291.

    • Author

    • Sawa N, Okamura K, Zendo T, Himeno K, Nakayama J, Sonomoto K.