• DRAMP ID

    • DRAMP00190
    • Peptide Name

    • Leucocin N (Bacteriocin)
    • Source

    • Leuconostoc pseudomesenteroides QU 15 (Gram-positive bacteria)
    • Family

    • Belongs to the class IId bacteriocin
    • Gene

    • LccN
    • Sequence

    • MNKEYNSISNFKKITNKDLQNINGGFIGRAIGDFVYFGAKGLRESGKLLNYYYKHKH
    • Sequence Length

    • 57
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknown
    • Biological Activity

    • Antibacterial, Anti-Gram+, Antimicrobial
    • Target Organism

      • Gram-positive bacteria: Bacillus circulans JCM 2504T (MIC=5.20 µmol/L), Listeria innocua ATCC 33090 (MIC=1.30 µmol/L), Listeria monocytogenes ATCC BAA-679 (MIC=1.30 µmol/L), Enterococcus faecalis JCM 5803 (MIC=5.20 µmol/L), Lactobacillus plantarum ATCC 14917 (MIC=2.60 µmol/L), Lactobacillus sakei ssp. sakei JCM 1157 (MIC=1.30 µmol/L), Leuconostoc mesenteroides ssp. mesenteroides JCM 6124 (MIC=2.60 µmol/L).
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Formula

    • C301H461N83O83S
    • Absent Amino Acids

    • CPW
    • Common Amino Acids

    • KGN
    • Mass

    • 7601.58
    • PI

    • 10.3
    • Basic Residues

    • 12
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 16
    • Boman Index

    • -107.32
    • Hydrophobicity

    • -74.39
    • Aliphatic Index

    • 70.18
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7450
    • Absorbance 280nm

    • 133.04
    • Polar Residues

    • 23

DRAMP00190

DRAMP00190 chydropathy plot
    • Leuc.pseudomesenteroides QU 15 (isolated from Nukadoko) produce at least three bacteriocins, leucocin A, and two novel bacteriocins termed leucocin Q and leucocin N.

  • Literature 1
    • Reference

    • J Appl Microbiol. 2010 Jul;109(1):282-291.
    • Author

    • Sawa N, Okamura K, Zendo T, Himeno K, Nakayama J, Sonomoto K.
    • Title

    • Identification and characterization of novel multiple bacteriocins produced by Leuconostoc pseudomesenteroides QU 15.