General Information

    • DRAMP ID

    • DRAMP00195

    • Peptide Name

    • Colicin-V (Microcin-V; Bacteriocin)

    • Source

    • Escherichia coli (Gram-negative bacteria)

    • Family

    • Belongs to the class IIa microcin

    • Gene

    • cvaC

    • Sequence

    • ASGRDIAMAIGTLSGQFVAGGIGAAAGGVAGGAIYDYASTHKPNPAMSPSGLGGTIKQKPEGIPSEAWNYAAGRLCNWSPNNLSDVCL

    • Sequence Length

    • 88

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli (also closely related bacteria), Enterobacteriaceae.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00195 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00195.

Physicochemical Information

    • Formula

    • C381H594N108O120S4

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • GA

    • Mass

    • 8735.8

    • PI

    • 6.78

    • Basic Residues

    • 6

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 31

    • Net Charge

    • +1

    • Boman Index

    • -49.96

    • Hydrophobicity

    • -0.003

    • Aliphatic Index

    • 74.55

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 15595

    • Absorbance 280nm

    • 179.25

    • Polar Residues

    • 36

DRAMP00195

DRAMP00195 chydropathy plot

Comments Information

    • Function

    • Colicin V kills sensitive cells by disrupting the membrane potential. It targets bacterial membranes and induces ion channel formation, leading to the disruption of the proton-motive force and hence ATP production.

    • PTM

    • Contains one disulfide bond between 76-87.

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of colicin V from Escherichia coli culture supernatants.

    • Reference

    • Biochemistry. 1994 Jun 7;33(22):6911-6917.

    • Author

    • Fath MJ, Zhang LH, Rush J, Kolter R.
  • ·Literature 2

    • Title

    • The leader peptide of colicin V shares consensus sequences with leader peptides that are common among peptide bacteriocins produced by Gram-positive bacteria.

    • Reference

    • Microbiology. 1994 Sep;140 (Pt 9):2383-2389.

    • Author

    • H¥varstein LS, Holo H, Nes IF.
  • ·Literature 3

    • Title

    • Genetic analysis of an MDR-like export system: the secretion of colicin V.

    • Reference

    • EMBO J. 1990 Dec;9(12):3875-3884.

    • Author

    • Gilson L, Mahanty HK, Kolter R.