General Information

    • DRAMP ID

    • DRAMP00196

    • Peptide Name

    • Microcin L (MccL; Bacteriocin)

    • Source

    • Escherichia coli (Gram-negative bacteria)

    • Family

    • Belongs to the class IIa microcin

    • Gene

    • mclC

    • Sequence

    • GDVNWVDVGKTVATNGAGVIGGAFGAGLCGPVCAGAFAVGSSAAVAALYDAAGNSNSAKQKPEGLPPEAWNYAEGRMCNWSPNNLSDVCL

    • Sequence Length

    • 90

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Klebsiella oxytoca CIP666, Salmonella enterica serovar Agon, S. enterica serovar Braenderup, S. enterica serovar Brandenburg, S. enterica serovar Bredeney, S. enterica serovar Derby, S. enterica serovar Dublin, S. enterica serovar Enteritidis ATCC 13076, S. enterica serovar Hadar, S. enterica serovar Heildeberg, S. enterica serovar Indiana, S. enterica serovar Kottbus, S. enterica serovar Newport, S. enterica serovar St.Paul, S. enterica serovar Typhimurium CIP5858, S. enterica serovar Virchow, Shigella sonnei CIP5236, Shigella flexneri CIP5236, Pseudomonas aeruginosa CIP100720T, Pseudomonas aeruginosa ATCC 27853.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00196 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00196.

Physicochemical Information

    • Formula

    • C386H590N108O124S5

    • Absent Amino Acids

    • H

    • Common Amino Acids

    • A

    • Mass

    • 8887.88

    • PI

    • 4.39

    • Basic Residues

    • 4

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 36

    • Net Charge

    • -3

    • Boman Index

    • -42.94

    • Hydrophobicity

    • 0.114

    • Aliphatic Index

    • 72.78

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 19730

    • Absorbance 280nm

    • 221.69

    • Polar Residues

    • 36

DRAMP00196

DRAMP00196 chydropathy plot

Comments Information

    • It targets bacterial membranes and induces ion channel formation, leading to the disruption of the proton-motive force and hence ATP production.

Literature Information

  • ·Literature 1

    • Title

    • Genetic analysis and complete primary structure of microcin L.

    • Reference

    • Antimicrob Agents Chemother. 2004 Feb;48(2):505-513.

    • Author

    • Pons AM, Delalande F, Duarte M, Benoit S, Lanneluc I, Sabl© S, Van Dorsselaer A, Cottenceau G.
  • ·Literature 2

    • Title

    • Wild-type Escherichia coli producing microcins B17, D93, J25, and L; cloning of genes for microcin L production and immunity.

    • Reference

    • Can J Microbiol. 2003 May;49(5):357-361.

    • Author

    • Sabl© S, Duarte M, Bravo D, Lanneluc I, Pons AM, Cottenceau G, Moreno F.