General Information

    • DRAMP ID

    • DRAMP00197

    • Peptide Name

    • Microcin 24 (Mcc24; Bacteriocin)

    • Source

    • Escherichia coli (Gram-negative bacteria)

    • Family

    • Belongs to the class IIa microcin

    • Gene

    • mtfS

    • Sequence

    • AGDPLADPNSQIVRQIMSNAAWGPPLVPERFRGMAVGAAGGVTQTVLQGAAAHMPVNVPIPKVPMGPSWNGSKG

    • Sequence Length

    • 74

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Salmonella typhimurium.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00197 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00197.

Physicochemical Information

    • Formula

    • C332H529N97O95S4

    • Absent Amino Acids

    • CY

    • Common Amino Acids

    • AGP

    • Mass

    • 7527.69

    • PI

    • 9.98

    • Basic Residues

    • 6

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 27

    • Net Charge

    • +3

    • Boman Index

    • -45.85

    • Hydrophobicity

    • -0.034

    • Aliphatic Index

    • 76.49

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11000

    • Absorbance 280nm

    • 150.68

    • Polar Residues

    • 20

DRAMP00197

DRAMP00197 chydropathy plot

Comments Information

    • MOA

    • It targets bacterial membranes and induces ion channel formation, leading to the disruption of the proton-motive force and hence ATP production.

Literature Information

  • ·Literature 1

    • Title

    • Complete nucleotide sequence of microcin 24 genetic region and analysis of a new ABC transporter.

    • Reference

    • Submitted (JAN-1996) to the EMBL/GenBank/DDBJ databases.

    • Author

    • O'Brien G.J, Mahanty H.K.