• DRAMP ID

    • DRAMP00197
    • Peptide Name

    • Microcin 24 (Mcc24; Bacteriocin)
    • Source

    • Escherichia coli (Gram-negative bacteria)
    • Family

    • Belongs to the class IIa microcin
    • Gene

    • mtfS
    • Sequence

    • AGDPLADPNSQIVRQIMSNAAWGPPLVPERFRGMAVGAAGGVTQTVLQGAAAHMPVNVPIPKVPMGPSWNGSKG
    • Sequence Length

    • 74
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Salmonella typhimurium.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00197 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00197.
    • Formula

    • C332H529N97O95S4
    • Absent Amino Acids

    • CY
    • Common Amino Acids

    • AGP
    • Mass

    • 7527.69
    • PI

    • 9.98
    • Basic Residues

    • 6
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 27
    • Net Charge

    • +3
    • Boman Index

    • -45.85
    • Hydrophobicity

    • -0.034
    • Aliphatic Index

    • 76.49
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11000
    • Absorbance 280nm

    • 150.68
    • Polar Residues

    • 20

DRAMP00197

DRAMP00197 chydropathy plot
    • MOA

    • It targets bacterial membranes and induces ion channel formation, leading to the disruption of the proton-motive force and hence ATP production.
  • ·Literature 1
    • Title

    • Complete nucleotide sequence of microcin 24 genetic region and analysis of a new ABC transporter.
    • Reference

    • Submitted (JAN-1996) to the EMBL/GenBank/DDBJ databases.
    • Author

    • O'Brien G.J, Mahanty H.K.