General Information

    • DRAMP ID

    • DRAMP00199

    • Peptide Name

    • Microcin I47 (MccI47; Bacteriocin)

    • Source

    • Escherichia coli H47 (Gram-negative bacteria)

    • Family

    • Belongs to the class IIb microcin

    • Gene

    • Not found

    • Sequence

    • MNLNGLPASTNVIDLRGKDMGTYIDANGACWAPDTPSIIMYPGGSGPSYSMSSSTSSANSGS

    • Sequence Length

    • 62

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00199 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00199.

Physicochemical Information

    • Formula

    • C264H412N72O95S5

    • Absent Amino Acids

    • EFHQ

    • Common Amino Acids

    • S

    • Mass

    • 6274.9

    • PI

    • 4.14

    • Basic Residues

    • 2

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 14

    • Net Charge

    • -2

    • Boman Index

    • -71.99

    • Hydrophobicity

    • -0.252

    • Aliphatic Index

    • 56.77

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 9970

    • Absorbance 280nm

    • 163.44

    • Polar Residues

    • 33

DRAMP00199

DRAMP00199 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Comparative analysis of chromosome-encoded microcins.

    • Reference

    • Antimicrob Agents Chemother. 2006 Apr;50(4):1411-1418.

    • Author

    • Poey ME, Azpiroz MF, Lavi±a M.