General Information

    • DRAMP ID

    • DRAMP00200

    • Peptide Name

    • Microcin M (MccM; Bacteriocin)

    • Source

    • Escherichia coli MC4100 (Gram-negative bacteria)

    • Family

    • Belongs to the class IIb microcin

    • Gene

    • Not found

    • Sequence

    • DGNDGQAELIAIGSLAGTFISPGFGSIAGAYIGDKVHSWATTATVSPSMSPSGIGLSSQFGSGRGTSSASSSAGSGS

    • Sequence Length

    • 77

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00200 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00200.

Physicochemical Information

    • Formula

    • C311H485N87O113S

    • Absent Amino Acids

    • C

    • Common Amino Acids

    • S

    • Mass

    • 7282.85

    • PI

    • 4.66

    • Basic Residues

    • 3

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 24

    • Net Charge

    • -1

    • Boman Index

    • -53.64

    • Hydrophobicity

    • 0.082

    • Aliphatic Index

    • 64.81

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 91.97

    • Polar Residues

    • 40

DRAMP00200

DRAMP00200 chydropathy plot

Comments Information

    • All Belongs to the class IIb microcins such as MccE492 have a Ser-rich C-terminal region and they may carry a siderophore-type PTM.

Literature Information

  • ·Literature 1

    • Title

    • Microcins, gene-encoded antibacterial peptides from enterobacteria.

    • Reference

    • Nat Prod Rep. 2007 Aug;24(4):708-734.

    • Author

    • Duquesne S, Destoumieux-Garz³n D, Peduzzi J, Rebuffat S.