General Information

    • DRAMP ID

    • DRAMP00206

    • Peptide Name

    • Acidocin A (Bacteriocin)

    • Source

    • Lactobacillus acidophilus TK9201 (Gram-positive bacteria)

    • Family

    • Not found

    • Gene

    • acdA

    • Sequence

    • KTYYGTNGVHCTKKSLWGKVRLKNVIPGTLCRKQSLPIKQDLKILLGWATGAFGKTFH

    • Sequence Length

    • 58

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Listeria monocytogenes, Clostridium sporogenes, Brochothrix thermosphacta, Lactobacillus fermentum, Lactobacillus delbrueckii subsp. Bulgaricus. Inmost other Lactobacillus species.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00206 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00206.

Physicochemical Information

    • Formula

    • C299H481N83O75S2

    • Absent Amino Acids

    • EM

    • Common Amino Acids

    • K

    • Mass

    • 6502.74

    • PI

    • 10.26

    • Basic Residues

    • 13

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +12

    • Boman Index

    • -59.99

    • Hydrophobicity

    • -0.298

    • Aliphatic Index

    • 85.69

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 14105

    • Absorbance 280nm

    • 247.46

    • Polar Residues

    • 21

DRAMP00206

DRAMP00206 chydropathy plot

Comments Information

    • Function

    • Acidocin A is active against closely related lactic acid bacteria and food-borne pathogens including Listeria monocytogenes.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of acidocin A and cloning of the bacteriocin gene from Lactobacillus acidophilus.

    • Reference

    • Appl Environ Microbiol. 1995 Mar;61(3):1061-1067.

    • Author

    • Kanatani K, Oshimura M, Sano K.